Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NHH7

Protein Details
Accession A8NHH7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
188-215GDTTGPARKNPKFKHKKGKEKAQGDVWHBasic
NLS Segment(s)
PositionSequence
56-66AQKKRIRKLAP
194-208ARKNPKFKHKKGKEK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG cci:CC1G_10828  -  
Amino Acid Sequences MALKRKNDLVNPDPTEKSGKKLRLSEEGDVVDTPSVENPPSSNAKGKEKAGEENMAQKKRIRKLAPPRPFPLVPTSVSVTGPHSAHKEGKNFICISRRNGLGAYLRRYKTLHLSAMGAAIPLLLQLSCALPPILPFSKDEIHTEVLTGTCEVQDEIIPEDDQEDIDIQSRFKSTLQVVIRIGDGQFEGDTTGPARKNPKFKHKKGKEKAQGDVWHEPEQEDDLMETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.45
4 0.45
5 0.44
6 0.46
7 0.48
8 0.53
9 0.56
10 0.57
11 0.61
12 0.58
13 0.54
14 0.48
15 0.42
16 0.36
17 0.32
18 0.22
19 0.17
20 0.14
21 0.1
22 0.1
23 0.09
24 0.1
25 0.09
26 0.14
27 0.19
28 0.21
29 0.27
30 0.3
31 0.38
32 0.42
33 0.44
34 0.46
35 0.43
36 0.46
37 0.42
38 0.42
39 0.34
40 0.39
41 0.45
42 0.42
43 0.41
44 0.39
45 0.44
46 0.47
47 0.55
48 0.5
49 0.51
50 0.6
51 0.69
52 0.75
53 0.74
54 0.7
55 0.68
56 0.64
57 0.56
58 0.51
59 0.42
60 0.34
61 0.29
62 0.28
63 0.23
64 0.23
65 0.21
66 0.18
67 0.18
68 0.17
69 0.16
70 0.16
71 0.17
72 0.22
73 0.25
74 0.27
75 0.28
76 0.29
77 0.32
78 0.3
79 0.3
80 0.32
81 0.31
82 0.32
83 0.31
84 0.3
85 0.27
86 0.26
87 0.26
88 0.25
89 0.27
90 0.28
91 0.31
92 0.31
93 0.31
94 0.32
95 0.31
96 0.31
97 0.3
98 0.26
99 0.2
100 0.2
101 0.19
102 0.19
103 0.18
104 0.11
105 0.07
106 0.05
107 0.04
108 0.03
109 0.03
110 0.02
111 0.02
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.1
120 0.11
121 0.11
122 0.12
123 0.15
124 0.18
125 0.2
126 0.21
127 0.19
128 0.2
129 0.2
130 0.19
131 0.16
132 0.13
133 0.12
134 0.11
135 0.08
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.08
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.08
149 0.08
150 0.07
151 0.06
152 0.09
153 0.1
154 0.09
155 0.1
156 0.11
157 0.12
158 0.12
159 0.16
160 0.14
161 0.22
162 0.23
163 0.27
164 0.27
165 0.26
166 0.26
167 0.23
168 0.22
169 0.15
170 0.13
171 0.09
172 0.08
173 0.07
174 0.08
175 0.07
176 0.08
177 0.08
178 0.14
179 0.14
180 0.18
181 0.27
182 0.32
183 0.43
184 0.51
185 0.61
186 0.67
187 0.76
188 0.84
189 0.86
190 0.91
191 0.91
192 0.94
193 0.93
194 0.88
195 0.85
196 0.82
197 0.79
198 0.74
199 0.72
200 0.65
201 0.6
202 0.54
203 0.48
204 0.4
205 0.36
206 0.29
207 0.21