Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NCY7

Protein Details
Accession A8NCY7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-110PLPAHRKSRQRLHSPSRNTCCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
IPR025563  DUF4286  
Gene Ontology GO:0016491  F:oxidoreductase activity  
GO:0051716  P:cellular response to stimulus  
GO:0042221  P:response to chemical  
KEGG cci:CC1G_08611  -  
Pfam View protein in Pfam  
PF14114  DUF4286  
Amino Acid Sequences MTKPEAQGLLYVLGEPGASVSEEEFNVWYDKDHAPLRLKVPGFQTAARYRSSDGHQPTWLAIYDLDTPEIAYSDACKALSTNAPQYELPLPAHRKSRQRLHSPSRNTCCTRSSRGRNKDSEGSVGRCYNGGFQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.05
5 0.05
6 0.05
7 0.06
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.11
16 0.13
17 0.14
18 0.18
19 0.19
20 0.23
21 0.27
22 0.31
23 0.32
24 0.35
25 0.35
26 0.33
27 0.34
28 0.34
29 0.32
30 0.3
31 0.33
32 0.32
33 0.33
34 0.31
35 0.29
36 0.25
37 0.26
38 0.28
39 0.29
40 0.28
41 0.29
42 0.28
43 0.28
44 0.26
45 0.24
46 0.21
47 0.14
48 0.1
49 0.09
50 0.1
51 0.1
52 0.1
53 0.08
54 0.08
55 0.08
56 0.08
57 0.06
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.08
66 0.11
67 0.13
68 0.17
69 0.17
70 0.19
71 0.19
72 0.22
73 0.22
74 0.2
75 0.2
76 0.22
77 0.25
78 0.27
79 0.35
80 0.38
81 0.44
82 0.5
83 0.58
84 0.61
85 0.66
86 0.73
87 0.75
88 0.79
89 0.81
90 0.83
91 0.81
92 0.8
93 0.74
94 0.67
95 0.62
96 0.59
97 0.58
98 0.58
99 0.62
100 0.65
101 0.71
102 0.76
103 0.76
104 0.77
105 0.76
106 0.68
107 0.65
108 0.6
109 0.54
110 0.5
111 0.46
112 0.4
113 0.33
114 0.31
115 0.26