Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YN96

Protein Details
Accession A0A316YN96   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-150PQPLKQQRSGKRPYKKKATAVSRPQKLHydrophilic
NLS Segment(s)
PositionSequence
131-141RSGKRPYKKKA
Subcellular Location(s) nucl 13, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MRSMRPTCLLSLIAAVLLSSHSYQNPSPGNDDYRPEKRIRLFGQDIEPSKPVESTYNGSASSEKTSTQPYGQDSSNILHPYRERIPSQLKAIHYEQGSLAAKYTSSAAPEQSSFMHDARRVPLPQPLKQQRSGKRPYKKKATAVSRPQKLTRVAEALVKENGQLASRENLQLIQLRLDKWLESTPVAPETITAFQRASEGQVEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.07
4 0.06
5 0.07
6 0.07
7 0.09
8 0.1
9 0.13
10 0.14
11 0.21
12 0.25
13 0.26
14 0.29
15 0.31
16 0.36
17 0.35
18 0.4
19 0.4
20 0.42
21 0.44
22 0.42
23 0.44
24 0.43
25 0.49
26 0.48
27 0.49
28 0.47
29 0.47
30 0.51
31 0.51
32 0.49
33 0.43
34 0.41
35 0.33
36 0.29
37 0.26
38 0.2
39 0.17
40 0.17
41 0.18
42 0.19
43 0.2
44 0.19
45 0.2
46 0.2
47 0.19
48 0.19
49 0.16
50 0.14
51 0.14
52 0.17
53 0.18
54 0.18
55 0.2
56 0.19
57 0.22
58 0.21
59 0.22
60 0.2
61 0.19
62 0.22
63 0.21
64 0.18
65 0.17
66 0.17
67 0.21
68 0.23
69 0.26
70 0.22
71 0.26
72 0.32
73 0.33
74 0.36
75 0.36
76 0.32
77 0.33
78 0.33
79 0.32
80 0.26
81 0.24
82 0.19
83 0.2
84 0.2
85 0.16
86 0.14
87 0.11
88 0.1
89 0.1
90 0.11
91 0.06
92 0.07
93 0.08
94 0.08
95 0.09
96 0.09
97 0.1
98 0.09
99 0.1
100 0.11
101 0.11
102 0.13
103 0.13
104 0.15
105 0.16
106 0.2
107 0.2
108 0.18
109 0.25
110 0.27
111 0.3
112 0.39
113 0.46
114 0.47
115 0.53
116 0.61
117 0.62
118 0.67
119 0.72
120 0.71
121 0.72
122 0.78
123 0.8
124 0.82
125 0.81
126 0.8
127 0.79
128 0.8
129 0.79
130 0.8
131 0.81
132 0.77
133 0.74
134 0.69
135 0.65
136 0.6
137 0.54
138 0.47
139 0.4
140 0.33
141 0.33
142 0.32
143 0.3
144 0.26
145 0.23
146 0.19
147 0.18
148 0.17
149 0.14
150 0.13
151 0.13
152 0.14
153 0.17
154 0.17
155 0.16
156 0.16
157 0.17
158 0.2
159 0.19
160 0.22
161 0.22
162 0.22
163 0.24
164 0.24
165 0.23
166 0.21
167 0.23
168 0.2
169 0.19
170 0.2
171 0.2
172 0.21
173 0.21
174 0.18
175 0.15
176 0.17
177 0.2
178 0.2
179 0.19
180 0.17
181 0.17
182 0.19
183 0.19
184 0.18
185 0.16
186 0.16