Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YVC8

Protein Details
Accession A0A316YVC8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-133LAAKVEKPSRKLRKERKNRAKKVRGVAKKKGSGDKKKBasic
NLS Segment(s)
PositionSequence
89-133RHRLVKKGLAAKVEKPSRKLRKERKNRAKKVRGVAKKKGSGDKKK
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDSTSPVTLRTRKFITNPLLQRKQMVLDVIHPTRANVSKDELEDKLSTMYKAQKEQCVVFGMRTHYGGGRSTGFALIYDSRDSMNFEPRHRLVKKGLAAKVEKPSRKLRKERKNRAKKVRGVAKKKGSGDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.53
4 0.59
5 0.63
6 0.66
7 0.62
8 0.61
9 0.54
10 0.49
11 0.41
12 0.35
13 0.25
14 0.23
15 0.29
16 0.27
17 0.29
18 0.26
19 0.24
20 0.26
21 0.3
22 0.27
23 0.22
24 0.25
25 0.25
26 0.26
27 0.29
28 0.25
29 0.23
30 0.21
31 0.2
32 0.18
33 0.17
34 0.15
35 0.15
36 0.2
37 0.2
38 0.26
39 0.28
40 0.29
41 0.31
42 0.31
43 0.3
44 0.28
45 0.25
46 0.2
47 0.2
48 0.18
49 0.16
50 0.16
51 0.15
52 0.12
53 0.13
54 0.13
55 0.12
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.1
69 0.13
70 0.12
71 0.2
72 0.22
73 0.23
74 0.29
75 0.31
76 0.39
77 0.38
78 0.4
79 0.36
80 0.41
81 0.45
82 0.46
83 0.47
84 0.45
85 0.46
86 0.47
87 0.52
88 0.53
89 0.51
90 0.48
91 0.56
92 0.6
93 0.67
94 0.74
95 0.75
96 0.78
97 0.86
98 0.92
99 0.93
100 0.94
101 0.95
102 0.95
103 0.95
104 0.92
105 0.91
106 0.91
107 0.9
108 0.88
109 0.87
110 0.86
111 0.84
112 0.82
113 0.81