Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YUD7

Protein Details
Accession A0A316YUD7   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
71-119EAQRKKDVTLERKRKKQERERLDEMAKKMSAKKLERKKRRMGLTKKVSHBasic
NLS Segment(s)
PositionSequence
47-117KVAARNKMASIKEREKAMRDAKLAEAQRKKDVTLERKRKKQERERLDEMAKKMSAKKLERKKRRMGLTKKV
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTTTTTNAKITQAEAGPSSSKATSGGNGGARETNVAGVRKTPRWSDKVAARNKMASIKEREKAMRDAKLAEAQRKKDVTLERKRKKQERERLDEMAKKMSAKKLERKKRRMGLTKKVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.19
5 0.2
6 0.15
7 0.15
8 0.14
9 0.14
10 0.13
11 0.14
12 0.17
13 0.17
14 0.18
15 0.18
16 0.18
17 0.17
18 0.17
19 0.15
20 0.14
21 0.14
22 0.14
23 0.13
24 0.17
25 0.21
26 0.24
27 0.27
28 0.3
29 0.32
30 0.34
31 0.38
32 0.39
33 0.42
34 0.47
35 0.51
36 0.51
37 0.46
38 0.44
39 0.42
40 0.42
41 0.35
42 0.31
43 0.32
44 0.32
45 0.33
46 0.34
47 0.35
48 0.32
49 0.37
50 0.36
51 0.33
52 0.29
53 0.28
54 0.27
55 0.32
56 0.32
57 0.33
58 0.34
59 0.33
60 0.38
61 0.37
62 0.36
63 0.35
64 0.41
65 0.43
66 0.49
67 0.58
68 0.61
69 0.69
70 0.79
71 0.82
72 0.84
73 0.85
74 0.84
75 0.84
76 0.84
77 0.82
78 0.79
79 0.77
80 0.72
81 0.64
82 0.59
83 0.5
84 0.43
85 0.41
86 0.41
87 0.43
88 0.45
89 0.52
90 0.58
91 0.67
92 0.76
93 0.81
94 0.85
95 0.85
96 0.88
97 0.89
98 0.88
99 0.88