Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NL95

Protein Details
Accession A8NL95    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-164GKPGTNQGPNPEKKRRRRRRDLENNPDKYRQKBasic
NLS Segment(s)
PositionSequence
143-152PEKKRRRRRR
Subcellular Location(s) plas 18, nucl 3, golg 2, vacu 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cci:CC1G_05772  -  
Amino Acid Sequences MSEKPGIDYDGYGFTAAGAFYGMTVQDIFIQGSVSGIMFFMCAYGLYVFLETPHHLRKGRLPYITLSLFLLINSLLNSAINTFKIFFGLYNPSSGTEFILQWDEEEWPWASILQGVLWVLYIVVADGLLEDPGKPGTNQGPNPEKKRRRRRRDLENNPDKYRQKVDSPGSVIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.08
5 0.06
6 0.05
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.08
15 0.08
16 0.07
17 0.08
18 0.07
19 0.07
20 0.07
21 0.06
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.08
39 0.12
40 0.16
41 0.2
42 0.21
43 0.22
44 0.3
45 0.37
46 0.42
47 0.4
48 0.38
49 0.35
50 0.39
51 0.38
52 0.31
53 0.22
54 0.17
55 0.15
56 0.13
57 0.11
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.06
71 0.07
72 0.07
73 0.06
74 0.08
75 0.12
76 0.12
77 0.12
78 0.12
79 0.12
80 0.13
81 0.13
82 0.12
83 0.09
84 0.09
85 0.09
86 0.1
87 0.09
88 0.08
89 0.09
90 0.09
91 0.07
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.07
121 0.07
122 0.1
123 0.16
124 0.24
125 0.26
126 0.34
127 0.42
128 0.49
129 0.58
130 0.66
131 0.69
132 0.73
133 0.82
134 0.85
135 0.87
136 0.91
137 0.93
138 0.93
139 0.95
140 0.95
141 0.95
142 0.95
143 0.92
144 0.86
145 0.85
146 0.77
147 0.7
148 0.66
149 0.59
150 0.55
151 0.56
152 0.56
153 0.56
154 0.58