Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316Y9M0

Protein Details
Accession A0A316Y9M0   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-110GDNTNKKEFENKKQSKKRLMEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MSNSRRSTHNQASFREALVGRDYSCILSDTKFTGCTASHILPQSRPEYYEEVLGYDPRYYFHVSYGLLLEDKIHHAFDRGEWALYPIVFGDNTNKKEFENKKQSKKRLME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.39
4 0.31
5 0.29
6 0.27
7 0.2
8 0.2
9 0.2
10 0.15
11 0.15
12 0.14
13 0.12
14 0.11
15 0.12
16 0.13
17 0.13
18 0.13
19 0.13
20 0.13
21 0.12
22 0.14
23 0.17
24 0.16
25 0.19
26 0.21
27 0.22
28 0.22
29 0.25
30 0.25
31 0.21
32 0.21
33 0.2
34 0.2
35 0.19
36 0.2
37 0.17
38 0.15
39 0.15
40 0.14
41 0.12
42 0.1
43 0.09
44 0.07
45 0.1
46 0.11
47 0.11
48 0.11
49 0.13
50 0.12
51 0.13
52 0.13
53 0.11
54 0.09
55 0.09
56 0.08
57 0.07
58 0.09
59 0.1
60 0.09
61 0.09
62 0.1
63 0.11
64 0.11
65 0.18
66 0.16
67 0.16
68 0.15
69 0.17
70 0.17
71 0.16
72 0.15
73 0.09
74 0.09
75 0.09
76 0.09
77 0.16
78 0.23
79 0.26
80 0.29
81 0.3
82 0.29
83 0.39
84 0.46
85 0.49
86 0.52
87 0.59
88 0.67
89 0.77
90 0.86