Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YWX4

Protein Details
Accession A0A316YWX4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AATRIPIVKKRTKKFARHQSDRFKCVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5mito_nucl 10.5, nucl 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATRIPIVKKRTKKFARHQSDRFKCVGESWRKPKGIDSCVRRRFKGKISMPSIGYGSNKKTRHLMPNGYRRLVVSNPRDVDLLLMHNGSYAAEIAHNVSAKKRIDILEKAKVLGVKVTNANARVRAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.86
4 0.88
5 0.88
6 0.9
7 0.9
8 0.89
9 0.83
10 0.74
11 0.64
12 0.53
13 0.48
14 0.48
15 0.47
16 0.48
17 0.51
18 0.57
19 0.57
20 0.57
21 0.59
22 0.57
23 0.56
24 0.54
25 0.55
26 0.58
27 0.66
28 0.69
29 0.64
30 0.61
31 0.58
32 0.56
33 0.58
34 0.55
35 0.54
36 0.56
37 0.58
38 0.54
39 0.5
40 0.43
41 0.34
42 0.29
43 0.21
44 0.2
45 0.24
46 0.24
47 0.24
48 0.28
49 0.3
50 0.36
51 0.39
52 0.44
53 0.44
54 0.53
55 0.56
56 0.53
57 0.49
58 0.42
59 0.39
60 0.34
61 0.33
62 0.27
63 0.3
64 0.3
65 0.31
66 0.3
67 0.27
68 0.25
69 0.18
70 0.16
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.05
79 0.04
80 0.04
81 0.05
82 0.06
83 0.08
84 0.09
85 0.09
86 0.11
87 0.18
88 0.19
89 0.2
90 0.22
91 0.23
92 0.29
93 0.36
94 0.41
95 0.44
96 0.44
97 0.43
98 0.42
99 0.4
100 0.34
101 0.31
102 0.26
103 0.21
104 0.23
105 0.27
106 0.29
107 0.31
108 0.33
109 0.32
110 0.33