Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YRV7

Protein Details
Accession A0A316YRV7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
11-36AAKSGGGKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
5-29KSAIAAAAKSGGGKKKKWSKGKVKD
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKSAIAAAAKSGGGKKKKWSKGKVKDKAQNMVVLDQPTYDRILKEVPTFKMISQSTLIDRMKINGSLARVAIRHLEREGQIRRIIHHHGQLVYTRASAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.31
5 0.38
6 0.47
7 0.57
8 0.66
9 0.72
10 0.75
11 0.81
12 0.89
13 0.89
14 0.89
15 0.87
16 0.83
17 0.8
18 0.7
19 0.63
20 0.53
21 0.45
22 0.37
23 0.3
24 0.24
25 0.17
26 0.15
27 0.12
28 0.13
29 0.12
30 0.09
31 0.1
32 0.12
33 0.13
34 0.16
35 0.2
36 0.18
37 0.2
38 0.21
39 0.2
40 0.25
41 0.24
42 0.22
43 0.19
44 0.19
45 0.17
46 0.23
47 0.23
48 0.17
49 0.17
50 0.18
51 0.18
52 0.17
53 0.18
54 0.13
55 0.14
56 0.14
57 0.14
58 0.14
59 0.13
60 0.13
61 0.18
62 0.17
63 0.18
64 0.18
65 0.21
66 0.21
67 0.3
68 0.33
69 0.31
70 0.34
71 0.33
72 0.35
73 0.36
74 0.41
75 0.39
76 0.4
77 0.41
78 0.38
79 0.39
80 0.4
81 0.38
82 0.33