Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316Y9G8

Protein Details
Accession A0A316Y9G8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-92SLRPRVCHPKTRRHVRLLGPCFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044792  TAR1  
Gene Ontology GO:0043457  P:regulation of cellular respiration  
Amino Acid Sequences SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIYALTQILPHKASRPVDGAPEGSHLHSLSLRPRVCHPKTRRHVRLLGPCFKTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.64
4 0.63
5 0.65
6 0.57
7 0.55
8 0.51
9 0.49
10 0.44
11 0.37
12 0.35
13 0.29
14 0.28
15 0.22
16 0.17
17 0.17
18 0.15
19 0.16
20 0.12
21 0.1
22 0.11
23 0.12
24 0.12
25 0.11
26 0.11
27 0.09
28 0.08
29 0.08
30 0.06
31 0.05
32 0.05
33 0.07
34 0.08
35 0.09
36 0.1
37 0.1
38 0.12
39 0.17
40 0.18
41 0.18
42 0.2
43 0.19
44 0.21
45 0.22
46 0.2
47 0.16
48 0.17
49 0.16
50 0.14
51 0.14
52 0.12
53 0.12
54 0.12
55 0.14
56 0.16
57 0.24
58 0.24
59 0.25
60 0.33
61 0.42
62 0.46
63 0.55
64 0.57
65 0.6
66 0.7
67 0.79
68 0.8
69 0.77
70 0.8
71 0.8
72 0.83
73 0.81
74 0.79
75 0.72