Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YSI5

Protein Details
Accession A0A316YSI5    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-37IEVSAKKWKKRDMEKMAPRTEEHydrophilic
123-145EGSQSASKKRSKKEAKEVVNDDEHydrophilic
NLS Segment(s)
PositionSequence
22-25KWKK
130-135KKRSKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTEGEAAVDGRKHGSIEVSAKKWKKRDMEKMAPRTEEQLKSKLDKAGGMTLELVAKDGDGKTIKAMPLEMKHFGTGSVGYTISESLHLTLKTGEDEDGQPLSLFCTSNCTVIGSKPKESEAGEGSQSASKKRSKKEAKEVVNDDENDND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.23
4 0.29
5 0.32
6 0.4
7 0.46
8 0.52
9 0.56
10 0.6
11 0.62
12 0.65
13 0.72
14 0.73
15 0.78
16 0.82
17 0.85
18 0.83
19 0.76
20 0.66
21 0.6
22 0.57
23 0.53
24 0.46
25 0.43
26 0.41
27 0.41
28 0.44
29 0.41
30 0.35
31 0.3
32 0.28
33 0.27
34 0.24
35 0.21
36 0.18
37 0.15
38 0.15
39 0.13
40 0.11
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.08
47 0.09
48 0.09
49 0.12
50 0.12
51 0.11
52 0.12
53 0.12
54 0.14
55 0.17
56 0.18
57 0.16
58 0.16
59 0.15
60 0.15
61 0.13
62 0.1
63 0.08
64 0.07
65 0.06
66 0.06
67 0.06
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.09
81 0.08
82 0.09
83 0.11
84 0.1
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.07
92 0.13
93 0.14
94 0.15
95 0.15
96 0.16
97 0.16
98 0.2
99 0.29
100 0.27
101 0.29
102 0.3
103 0.3
104 0.31
105 0.32
106 0.32
107 0.25
108 0.24
109 0.22
110 0.21
111 0.21
112 0.22
113 0.22
114 0.21
115 0.23
116 0.27
117 0.34
118 0.41
119 0.51
120 0.58
121 0.67
122 0.76
123 0.81
124 0.83
125 0.85
126 0.83
127 0.79
128 0.75
129 0.66