Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A316YI63

Protein Details
Accession A0A316YI63    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPKAKRRRARKARTAAVVSDHydrophilic
NLS Segment(s)
PositionSequence
3-14PKAKRRRARKAR
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MPPKAKRRRARKARTAAVVSDSSSSDSDSSSSSSSSSSAVSGGVSEAKVKAVRAASAASSSASSSSSSSEEEEEEFEGEEQVRRKRMRRGQPSPMPSLSEERFWSDNDDDDEEGRWRRSRGPMRRERLPFDSHALRLLEASRAKRRGVEATLAQKEKEEQEQERRRQPGKQEQEEAFESMYMRAVVGEYAEELDAIRRKEPGLGDADDGGRMGLLIDALKAGSELFSRSDPDEVALVMGDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.83
3 0.74
4 0.68
5 0.58
6 0.48
7 0.39
8 0.3
9 0.24
10 0.2
11 0.18
12 0.14
13 0.13
14 0.12
15 0.12
16 0.13
17 0.12
18 0.12
19 0.11
20 0.11
21 0.12
22 0.12
23 0.11
24 0.09
25 0.09
26 0.08
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.09
33 0.08
34 0.11
35 0.12
36 0.12
37 0.15
38 0.15
39 0.15
40 0.15
41 0.16
42 0.14
43 0.15
44 0.15
45 0.11
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.1
54 0.1
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.1
67 0.13
68 0.16
69 0.22
70 0.26
71 0.3
72 0.4
73 0.49
74 0.57
75 0.64
76 0.68
77 0.72
78 0.77
79 0.77
80 0.73
81 0.64
82 0.55
83 0.46
84 0.43
85 0.33
86 0.27
87 0.23
88 0.21
89 0.21
90 0.19
91 0.22
92 0.17
93 0.18
94 0.17
95 0.18
96 0.15
97 0.14
98 0.15
99 0.13
100 0.14
101 0.14
102 0.14
103 0.13
104 0.16
105 0.25
106 0.34
107 0.41
108 0.51
109 0.58
110 0.62
111 0.7
112 0.7
113 0.65
114 0.6
115 0.53
116 0.45
117 0.4
118 0.37
119 0.29
120 0.29
121 0.24
122 0.2
123 0.17
124 0.16
125 0.16
126 0.16
127 0.2
128 0.24
129 0.26
130 0.26
131 0.27
132 0.29
133 0.29
134 0.28
135 0.28
136 0.26
137 0.32
138 0.37
139 0.36
140 0.34
141 0.3
142 0.29
143 0.28
144 0.28
145 0.24
146 0.23
147 0.33
148 0.43
149 0.49
150 0.55
151 0.59
152 0.56
153 0.57
154 0.61
155 0.61
156 0.62
157 0.62
158 0.61
159 0.56
160 0.59
161 0.55
162 0.48
163 0.37
164 0.27
165 0.21
166 0.15
167 0.14
168 0.09
169 0.08
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.09
181 0.13
182 0.14
183 0.15
184 0.15
185 0.16
186 0.2
187 0.2
188 0.2
189 0.21
190 0.22
191 0.22
192 0.23
193 0.23
194 0.19
195 0.18
196 0.14
197 0.09
198 0.07
199 0.06
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.06
211 0.08
212 0.1
213 0.11
214 0.14
215 0.16
216 0.17
217 0.17
218 0.17
219 0.17
220 0.14
221 0.14
222 0.11