Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YQG2

Protein Details
Accession A0A316YQG2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MHARFSSRKRARVRHEPRRAPRKQRVTDQWANRTHydrophilic
NLS Segment(s)
PositionSequence
7-24SRKRARVRHEPRRAPRKQ
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MHARFSSRKRARVRHEPRRAPRKQRVTDQWANRTWTQNPTTASEERIAAFLVLCWPLPCDNTSPITLPFLRRLVENHRDESPTPVKEGRAWISNREIRDQKISHERATRLLYIVASPLQRFEQAVNGLRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.9
4 0.91
5 0.92
6 0.92
7 0.91
8 0.91
9 0.91
10 0.87
11 0.86
12 0.85
13 0.84
14 0.83
15 0.82
16 0.79
17 0.73
18 0.7
19 0.63
20 0.57
21 0.5
22 0.48
23 0.42
24 0.38
25 0.36
26 0.35
27 0.37
28 0.33
29 0.32
30 0.26
31 0.25
32 0.2
33 0.19
34 0.15
35 0.1
36 0.09
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.09
46 0.1
47 0.11
48 0.13
49 0.14
50 0.14
51 0.14
52 0.16
53 0.16
54 0.15
55 0.16
56 0.15
57 0.15
58 0.14
59 0.16
60 0.22
61 0.3
62 0.31
63 0.31
64 0.31
65 0.33
66 0.33
67 0.37
68 0.35
69 0.27
70 0.27
71 0.26
72 0.25
73 0.25
74 0.29
75 0.25
76 0.26
77 0.27
78 0.27
79 0.34
80 0.37
81 0.36
82 0.39
83 0.39
84 0.35
85 0.42
86 0.39
87 0.37
88 0.44
89 0.46
90 0.45
91 0.49
92 0.47
93 0.45
94 0.48
95 0.43
96 0.34
97 0.32
98 0.27
99 0.21
100 0.21
101 0.19
102 0.17
103 0.16
104 0.17
105 0.17
106 0.17
107 0.18
108 0.17
109 0.2
110 0.24
111 0.29