Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YPX3

Protein Details
Accession A0A316YPX3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
318-343LSSMSQTPEREKKKQPKAHPNEGAITHydrophilic
NLS Segment(s)
PositionSequence
330-331KK
Subcellular Location(s) extr 12, golg 5, plas 3, nucl 2, mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKRLVFVLLFVAAMLASLATNAGCLDSQRDESAPMVKRVLGSGQHEEDEDRRSDESAPMVKRGLGTGQHEEEEDRPASSKPGSILERMARDEQQIQKTVDFYARYWRDRYRKAALELREQRGINQESHGGQETEQEGDGDDDGSIAVKASARCRPSIPQHESSDESDESAPMFKRGLGSGGSGQHEEGEDRPASSRPGSLLEQMAHDEQQIQKTVDFWARYWRDRYRKAALELRERREINQERHGGQEIKREGDDDDDGSIAYWLNRFEEVTEELERTPGSSRKREWEHEEEEKRRQDLARLMPPPAGVPNAQRFRRLSSMSQTPEREKKKQPKAHPNEGAITTEGSGGRLSKPERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.06
12 0.1
13 0.13
14 0.16
15 0.17
16 0.18
17 0.19
18 0.2
19 0.28
20 0.28
21 0.28
22 0.27
23 0.27
24 0.27
25 0.26
26 0.29
27 0.26
28 0.27
29 0.3
30 0.31
31 0.31
32 0.31
33 0.31
34 0.29
35 0.29
36 0.25
37 0.21
38 0.19
39 0.2
40 0.21
41 0.21
42 0.24
43 0.27
44 0.28
45 0.28
46 0.28
47 0.28
48 0.26
49 0.25
50 0.23
51 0.2
52 0.23
53 0.27
54 0.28
55 0.28
56 0.28
57 0.28
58 0.25
59 0.25
60 0.21
61 0.16
62 0.15
63 0.15
64 0.17
65 0.16
66 0.17
67 0.14
68 0.2
69 0.22
70 0.22
71 0.26
72 0.28
73 0.31
74 0.32
75 0.33
76 0.28
77 0.28
78 0.33
79 0.35
80 0.35
81 0.37
82 0.35
83 0.33
84 0.33
85 0.32
86 0.29
87 0.24
88 0.2
89 0.25
90 0.29
91 0.31
92 0.34
93 0.42
94 0.46
95 0.51
96 0.57
97 0.55
98 0.55
99 0.58
100 0.61
101 0.56
102 0.58
103 0.6
104 0.57
105 0.55
106 0.49
107 0.44
108 0.45
109 0.43
110 0.33
111 0.27
112 0.26
113 0.21
114 0.23
115 0.23
116 0.15
117 0.13
118 0.15
119 0.15
120 0.13
121 0.12
122 0.1
123 0.09
124 0.09
125 0.09
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.04
134 0.06
135 0.07
136 0.1
137 0.15
138 0.16
139 0.18
140 0.2
141 0.24
142 0.31
143 0.4
144 0.43
145 0.44
146 0.46
147 0.47
148 0.48
149 0.44
150 0.39
151 0.29
152 0.24
153 0.18
154 0.16
155 0.13
156 0.13
157 0.11
158 0.08
159 0.08
160 0.07
161 0.08
162 0.08
163 0.09
164 0.08
165 0.09
166 0.11
167 0.13
168 0.13
169 0.13
170 0.12
171 0.11
172 0.11
173 0.1
174 0.08
175 0.09
176 0.08
177 0.08
178 0.1
179 0.1
180 0.12
181 0.12
182 0.12
183 0.09
184 0.13
185 0.14
186 0.14
187 0.15
188 0.14
189 0.14
190 0.15
191 0.15
192 0.12
193 0.11
194 0.11
195 0.1
196 0.12
197 0.14
198 0.13
199 0.12
200 0.13
201 0.15
202 0.18
203 0.17
204 0.15
205 0.23
206 0.26
207 0.29
208 0.34
209 0.41
210 0.46
211 0.51
212 0.57
213 0.55
214 0.57
215 0.6
216 0.61
217 0.59
218 0.61
219 0.63
220 0.61
221 0.6
222 0.55
223 0.5
224 0.54
225 0.56
226 0.5
227 0.51
228 0.51
229 0.44
230 0.46
231 0.49
232 0.42
233 0.36
234 0.39
235 0.33
236 0.31
237 0.3
238 0.28
239 0.24
240 0.24
241 0.23
242 0.15
243 0.13
244 0.11
245 0.11
246 0.1
247 0.1
248 0.07
249 0.06
250 0.07
251 0.07
252 0.08
253 0.09
254 0.09
255 0.09
256 0.12
257 0.13
258 0.16
259 0.17
260 0.16
261 0.16
262 0.17
263 0.16
264 0.14
265 0.16
266 0.19
267 0.24
268 0.3
269 0.33
270 0.42
271 0.49
272 0.54
273 0.58
274 0.61
275 0.62
276 0.66
277 0.72
278 0.68
279 0.7
280 0.68
281 0.62
282 0.57
283 0.5
284 0.46
285 0.45
286 0.48
287 0.48
288 0.46
289 0.46
290 0.43
291 0.43
292 0.38
293 0.32
294 0.25
295 0.18
296 0.22
297 0.3
298 0.38
299 0.39
300 0.43
301 0.43
302 0.47
303 0.53
304 0.51
305 0.46
306 0.45
307 0.53
308 0.53
309 0.59
310 0.58
311 0.59
312 0.64
313 0.67
314 0.67
315 0.69
316 0.74
317 0.77
318 0.82
319 0.85
320 0.86
321 0.88
322 0.91
323 0.89
324 0.83
325 0.78
326 0.7
327 0.62
328 0.51
329 0.43
330 0.32
331 0.26
332 0.21
333 0.16
334 0.15
335 0.14
336 0.15
337 0.2