Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YIQ3

Protein Details
Accession A0A316YIQ3   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-173SARRKFGSWGDKRKREKRQADDDEBasic
300-321SGNSNSSKPGNKKTKKAKAKKRHydrophilic
NLS Segment(s)
PositionSequence
152-167RRKFGSWGDKRKREKR
199-217KGKKKGFIKPGTMGKRQRR
230-259RGAHAKARNEAAKKKRADMSSEEKAKMRRK
307-321KPGNKKTKKAKAKKR
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MASSGARQSHVSSLSGKIQGLKFMQRAAASNKGTTPASFSTASAAAKAASSNDAAPGPSSSSSRAKSGATEGRNAGPSVTQEQHSPAPSEPIADDGNEEHWVLPGKAAQRQAATNTAVESEELGWNAFLRQASASVDGENEKGGDPSSGSARRKFGSWGDKRKREKRQADDDEPDFDMSDDEDGALDYESDGHEGEDGKGKKKGFIKPGTMGKRQRREHNDDEVLQSGARGAHAKARNEAAKKKRADMSSEEKAKMRRKHGFYVPDPGADSDDGSDEPGDDSISVLDGASTTDTPPRSISGNSNSSKPGNKKTKKAKAKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.3
5 0.29
6 0.33
7 0.34
8 0.37
9 0.33
10 0.32
11 0.35
12 0.3
13 0.33
14 0.33
15 0.39
16 0.34
17 0.34
18 0.33
19 0.33
20 0.33
21 0.29
22 0.28
23 0.21
24 0.23
25 0.22
26 0.21
27 0.21
28 0.23
29 0.23
30 0.18
31 0.17
32 0.13
33 0.12
34 0.12
35 0.1
36 0.09
37 0.1
38 0.1
39 0.11
40 0.12
41 0.11
42 0.12
43 0.12
44 0.12
45 0.13
46 0.14
47 0.17
48 0.22
49 0.24
50 0.25
51 0.26
52 0.24
53 0.25
54 0.31
55 0.34
56 0.3
57 0.32
58 0.31
59 0.33
60 0.34
61 0.32
62 0.25
63 0.19
64 0.19
65 0.2
66 0.2
67 0.18
68 0.17
69 0.2
70 0.24
71 0.24
72 0.24
73 0.19
74 0.21
75 0.2
76 0.2
77 0.17
78 0.17
79 0.16
80 0.13
81 0.14
82 0.1
83 0.12
84 0.11
85 0.12
86 0.09
87 0.09
88 0.11
89 0.1
90 0.1
91 0.11
92 0.13
93 0.16
94 0.18
95 0.19
96 0.19
97 0.2
98 0.22
99 0.23
100 0.22
101 0.18
102 0.16
103 0.15
104 0.14
105 0.12
106 0.11
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.1
121 0.11
122 0.09
123 0.1
124 0.1
125 0.1
126 0.09
127 0.08
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.06
134 0.1
135 0.16
136 0.18
137 0.2
138 0.22
139 0.23
140 0.23
141 0.25
142 0.26
143 0.3
144 0.37
145 0.45
146 0.52
147 0.61
148 0.69
149 0.76
150 0.8
151 0.8
152 0.81
153 0.78
154 0.8
155 0.8
156 0.77
157 0.73
158 0.64
159 0.56
160 0.48
161 0.39
162 0.28
163 0.2
164 0.13
165 0.08
166 0.07
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.06
182 0.07
183 0.13
184 0.15
185 0.17
186 0.21
187 0.21
188 0.26
189 0.31
190 0.38
191 0.4
192 0.45
193 0.48
194 0.51
195 0.6
196 0.62
197 0.63
198 0.66
199 0.66
200 0.69
201 0.69
202 0.73
203 0.72
204 0.74
205 0.72
206 0.72
207 0.67
208 0.59
209 0.56
210 0.48
211 0.39
212 0.3
213 0.24
214 0.16
215 0.11
216 0.1
217 0.09
218 0.08
219 0.16
220 0.21
221 0.23
222 0.25
223 0.31
224 0.36
225 0.4
226 0.49
227 0.49
228 0.52
229 0.53
230 0.56
231 0.57
232 0.54
233 0.53
234 0.51
235 0.51
236 0.52
237 0.56
238 0.52
239 0.49
240 0.54
241 0.58
242 0.58
243 0.59
244 0.59
245 0.59
246 0.66
247 0.7
248 0.72
249 0.66
250 0.68
251 0.61
252 0.53
253 0.48
254 0.41
255 0.34
256 0.25
257 0.22
258 0.14
259 0.13
260 0.12
261 0.11
262 0.1
263 0.09
264 0.09
265 0.09
266 0.08
267 0.07
268 0.07
269 0.06
270 0.07
271 0.06
272 0.06
273 0.05
274 0.05
275 0.06
276 0.07
277 0.08
278 0.08
279 0.13
280 0.14
281 0.16
282 0.17
283 0.18
284 0.19
285 0.21
286 0.27
287 0.31
288 0.39
289 0.39
290 0.41
291 0.44
292 0.45
293 0.51
294 0.51
295 0.53
296 0.56
297 0.62
298 0.7
299 0.77
300 0.84
301 0.87