Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A316YPZ2

Protein Details
Accession A0A316YPZ2   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKPCKKHTPHKVTQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKPCKKHTPHKVTQYKTGKASLYAQGKRRYDAKQKGYGGQTKPVFHKKAKTTKKVVLRLECTACKYRSHMALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.9
5 0.89
6 0.9
7 0.9
8 0.89
9 0.88
10 0.89
11 0.89
12 0.82
13 0.82
14 0.79
15 0.73
16 0.65
17 0.6
18 0.49
19 0.42
20 0.41
21 0.38
22 0.38
23 0.38
24 0.42
25 0.46
26 0.46
27 0.46
28 0.47
29 0.47
30 0.48
31 0.53
32 0.53
33 0.53
34 0.54
35 0.56
36 0.56
37 0.56
38 0.47
39 0.45
40 0.41
41 0.35
42 0.38
43 0.41
44 0.4
45 0.36
46 0.42
47 0.43
48 0.51
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.4
64 0.34
65 0.34
66 0.34
67 0.38
68 0.44
69 0.46
70 0.49
71 0.58
72 0.65
73 0.7
74 0.69
75 0.62
76 0.57
77 0.53
78 0.51
79 0.52
80 0.53
81 0.52
82 0.53
83 0.51
84 0.49
85 0.48
86 0.42