Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B4A1

Protein Details
Accession A0A2V1B4A1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-123EKVIKVNIPNKKKRVKKTIIEEIPKRHydrophilic
NLS Segment(s)
PositionSequence
107-114NKKKRVKK
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 11, mito 3
Family & Domain DBs
Amino Acid Sequences MDETIDIFEEKHPNKVVVFIFNQLSTHASKGSGALNAFTMNLGEGGAPLPQKVSFSYTFPFRKYLLTLQNTYFPPNISESKRARGLVGTLQELNYKIEKVIKVNIPNKKKRVKKTIIEEIPKRIKQILVERGCLPIGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.32
4 0.28
5 0.29
6 0.27
7 0.26
8 0.25
9 0.25
10 0.21
11 0.21
12 0.17
13 0.16
14 0.13
15 0.12
16 0.12
17 0.13
18 0.14
19 0.14
20 0.13
21 0.12
22 0.12
23 0.12
24 0.12
25 0.1
26 0.08
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.07
39 0.08
40 0.11
41 0.11
42 0.13
43 0.15
44 0.22
45 0.24
46 0.24
47 0.26
48 0.23
49 0.23
50 0.23
51 0.27
52 0.28
53 0.29
54 0.3
55 0.28
56 0.33
57 0.32
58 0.32
59 0.27
60 0.19
61 0.17
62 0.18
63 0.21
64 0.18
65 0.26
66 0.26
67 0.3
68 0.33
69 0.32
70 0.3
71 0.26
72 0.25
73 0.22
74 0.22
75 0.19
76 0.16
77 0.17
78 0.17
79 0.18
80 0.18
81 0.14
82 0.12
83 0.11
84 0.15
85 0.16
86 0.17
87 0.22
88 0.26
89 0.34
90 0.41
91 0.49
92 0.55
93 0.62
94 0.68
95 0.72
96 0.76
97 0.77
98 0.81
99 0.81
100 0.81
101 0.82
102 0.84
103 0.84
104 0.85
105 0.79
106 0.78
107 0.78
108 0.7
109 0.63
110 0.54
111 0.47
112 0.44
113 0.5
114 0.5
115 0.46
116 0.48
117 0.46
118 0.46