Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BY94

Protein Details
Accession A0A2V1BY94    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
296-316EGLIVRKRRGAQVKKIKEDTAHydrophilic
NLS Segment(s)
PositionSequence
299-310IVRKRRGAQVKK
Subcellular Location(s) cyto 15.5, cyto_nucl 11.833, cyto_mito 11.166, nucl 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022694  3-OHacyl-CoA_DH  
IPR006176  3-OHacyl-CoA_DH_NAD-bd  
IPR006108  3HC_DH_C  
IPR008927  6-PGluconate_DH-like_C_sf  
IPR013328  6PGD_dom2  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0070403  F:NAD+ binding  
GO:0016616  F:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor  
GO:0006631  P:fatty acid metabolic process  
Pfam View protein in Pfam  
PF00725  3HCDH  
PF02737  3HCDH_N  
Amino Acid Sequences PSGPAWAPPPSIKEKPIAILGAGVLGRRLAVLWASTSRPVTLYDTSPSALKSSRTYVADSLANNCFSQGTHPGHVSFSSKLEDAVQDAWMVIECVPEDLELKISLLGRVDRLVGKDVLIATNSAGFRSAELISEVFYKERVLNTLYYIPPRNKCVEIMSCGYTSPSIIPFLVEELQDIGLRPIVVPDSVGNGSLSKGMIFPRIWGAMKKETLKVLSEGVADPEEVDILFRDFFGAEKGPCEMMDEVGLDTVVRSERSRLPNMREGDGFWGARGEEYVEWLDREFVRRGKLGVKSGEGLIVRKRRGAQVKKIKEDTAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.41
4 0.36
5 0.28
6 0.24
7 0.21
8 0.19
9 0.17
10 0.14
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.06
17 0.06
18 0.07
19 0.1
20 0.13
21 0.15
22 0.18
23 0.19
24 0.19
25 0.18
26 0.2
27 0.22
28 0.22
29 0.22
30 0.22
31 0.23
32 0.23
33 0.24
34 0.22
35 0.2
36 0.19
37 0.19
38 0.19
39 0.22
40 0.27
41 0.27
42 0.3
43 0.28
44 0.3
45 0.3
46 0.28
47 0.28
48 0.25
49 0.25
50 0.22
51 0.21
52 0.18
53 0.15
54 0.17
55 0.2
56 0.21
57 0.22
58 0.24
59 0.24
60 0.25
61 0.26
62 0.26
63 0.2
64 0.18
65 0.17
66 0.16
67 0.16
68 0.16
69 0.15
70 0.14
71 0.14
72 0.12
73 0.1
74 0.09
75 0.09
76 0.08
77 0.08
78 0.06
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.06
86 0.07
87 0.07
88 0.07
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.09
95 0.1
96 0.11
97 0.11
98 0.12
99 0.14
100 0.13
101 0.12
102 0.13
103 0.13
104 0.12
105 0.11
106 0.1
107 0.07
108 0.1
109 0.1
110 0.09
111 0.09
112 0.09
113 0.08
114 0.11
115 0.11
116 0.07
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.1
129 0.1
130 0.12
131 0.16
132 0.16
133 0.18
134 0.21
135 0.24
136 0.25
137 0.27
138 0.28
139 0.25
140 0.25
141 0.26
142 0.24
143 0.23
144 0.23
145 0.22
146 0.19
147 0.18
148 0.18
149 0.14
150 0.12
151 0.09
152 0.07
153 0.06
154 0.06
155 0.06
156 0.06
157 0.07
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.08
175 0.08
176 0.09
177 0.08
178 0.08
179 0.09
180 0.09
181 0.09
182 0.06
183 0.07
184 0.07
185 0.11
186 0.1
187 0.11
188 0.13
189 0.15
190 0.16
191 0.17
192 0.21
193 0.22
194 0.26
195 0.28
196 0.28
197 0.28
198 0.28
199 0.28
200 0.25
201 0.2
202 0.18
203 0.16
204 0.14
205 0.14
206 0.12
207 0.11
208 0.09
209 0.08
210 0.07
211 0.06
212 0.06
213 0.05
214 0.05
215 0.06
216 0.05
217 0.06
218 0.06
219 0.06
220 0.08
221 0.11
222 0.1
223 0.11
224 0.12
225 0.12
226 0.12
227 0.15
228 0.13
229 0.11
230 0.11
231 0.11
232 0.1
233 0.09
234 0.09
235 0.06
236 0.06
237 0.07
238 0.07
239 0.08
240 0.09
241 0.13
242 0.21
243 0.27
244 0.36
245 0.4
246 0.46
247 0.52
248 0.55
249 0.54
250 0.47
251 0.43
252 0.4
253 0.38
254 0.31
255 0.23
256 0.21
257 0.18
258 0.17
259 0.16
260 0.13
261 0.09
262 0.12
263 0.14
264 0.13
265 0.14
266 0.14
267 0.17
268 0.16
269 0.2
270 0.22
271 0.24
272 0.27
273 0.29
274 0.3
275 0.34
276 0.39
277 0.42
278 0.41
279 0.41
280 0.38
281 0.37
282 0.39
283 0.34
284 0.3
285 0.32
286 0.36
287 0.35
288 0.38
289 0.4
290 0.45
291 0.54
292 0.61
293 0.63
294 0.67
295 0.75
296 0.8
297 0.82