Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BCB3

Protein Details
Accession A0A2V1BCB3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-102IDHVKRIHLKRRDPHAKIKCYHBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSRVGSTLPVLWSPSAAAAKFLDGTDTPGCPIAATSRPGEIPRSRAIPLKLAKDQCPICIGDEWKSYKERMGSFCRPAKIIDHVKRIHLKRRDPHAKIKCYHLTCKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.15
5 0.14
6 0.15
7 0.15
8 0.15
9 0.13
10 0.11
11 0.15
12 0.14
13 0.14
14 0.14
15 0.14
16 0.14
17 0.12
18 0.12
19 0.11
20 0.13
21 0.15
22 0.15
23 0.15
24 0.17
25 0.18
26 0.22
27 0.21
28 0.21
29 0.22
30 0.24
31 0.23
32 0.26
33 0.27
34 0.29
35 0.3
36 0.31
37 0.34
38 0.34
39 0.34
40 0.36
41 0.35
42 0.29
43 0.27
44 0.23
45 0.19
46 0.19
47 0.19
48 0.16
49 0.2
50 0.22
51 0.22
52 0.23
53 0.22
54 0.22
55 0.25
56 0.26
57 0.27
58 0.33
59 0.37
60 0.42
61 0.47
62 0.46
63 0.43
64 0.4
65 0.38
66 0.38
67 0.43
68 0.43
69 0.47
70 0.47
71 0.52
72 0.6
73 0.63
74 0.64
75 0.62
76 0.64
77 0.64
78 0.74
79 0.78
80 0.75
81 0.81
82 0.81
83 0.81
84 0.75
85 0.75
86 0.74
87 0.68