Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CR33

Protein Details
Accession A0A2V1CR33    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-108KKSASMDKKHGKQRRVRFEDETSHQRRRVKREKSKMEERDSMBasic
NLS Segment(s)
PositionSequence
49-101SPRRKLKFIEKLFSAFHPKKSASMDKKHGKQRRVRFEDETSHQRRRVKREKSK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPASFAPRGRGHYLPHHHHQTDVKASFNDSDFDLDIDSLVIEKMPRNASPRRKLKFIEKLFSAFHPKKSASMDKKHGKQRRVRFEDETSHQRRRVKREKSKMEERDSMVEDDVRRISTISRHDTNPHRSSNIGASSAISNSKRAREKVDEKIEGWESDSSVLSSRDSEVNLGSIMGQPATPDSALLSHESLPQPQGLQEFQPSPPKSNPSWSDSRSQSRSSAHAQTSQGTATSSSTSRHVNTLSPSFTSIVPPVYTTYKPSESDFDQNRARRRAERSAVTPVLPPKTANSVHGKEPDRRVASPVARDLRARRAERTSETSAAEKYHRDERERLWSSQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.66
4 0.61
5 0.63
6 0.63
7 0.6
8 0.6
9 0.54
10 0.49
11 0.4
12 0.42
13 0.4
14 0.36
15 0.3
16 0.21
17 0.21
18 0.18
19 0.17
20 0.16
21 0.12
22 0.11
23 0.1
24 0.09
25 0.06
26 0.06
27 0.06
28 0.07
29 0.08
30 0.14
31 0.17
32 0.2
33 0.25
34 0.35
35 0.45
36 0.54
37 0.63
38 0.63
39 0.66
40 0.68
41 0.72
42 0.74
43 0.71
44 0.68
45 0.61
46 0.59
47 0.55
48 0.54
49 0.54
50 0.46
51 0.43
52 0.41
53 0.39
54 0.39
55 0.44
56 0.51
57 0.49
58 0.55
59 0.6
60 0.64
61 0.72
62 0.78
63 0.79
64 0.77
65 0.78
66 0.8
67 0.81
68 0.79
69 0.76
70 0.72
71 0.7
72 0.69
73 0.66
74 0.66
75 0.62
76 0.6
77 0.59
78 0.6
79 0.61
80 0.64
81 0.68
82 0.69
83 0.73
84 0.77
85 0.84
86 0.86
87 0.89
88 0.88
89 0.84
90 0.79
91 0.71
92 0.65
93 0.56
94 0.49
95 0.38
96 0.32
97 0.26
98 0.22
99 0.2
100 0.15
101 0.13
102 0.12
103 0.13
104 0.15
105 0.21
106 0.25
107 0.27
108 0.28
109 0.34
110 0.41
111 0.49
112 0.49
113 0.45
114 0.4
115 0.37
116 0.38
117 0.36
118 0.31
119 0.22
120 0.17
121 0.16
122 0.15
123 0.16
124 0.17
125 0.13
126 0.15
127 0.15
128 0.22
129 0.25
130 0.26
131 0.31
132 0.36
133 0.42
134 0.48
135 0.54
136 0.5
137 0.46
138 0.48
139 0.44
140 0.36
141 0.31
142 0.22
143 0.14
144 0.13
145 0.12
146 0.09
147 0.09
148 0.09
149 0.07
150 0.08
151 0.08
152 0.08
153 0.09
154 0.09
155 0.08
156 0.08
157 0.07
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.05
171 0.06
172 0.07
173 0.07
174 0.08
175 0.11
176 0.12
177 0.12
178 0.12
179 0.12
180 0.11
181 0.11
182 0.12
183 0.09
184 0.1
185 0.11
186 0.13
187 0.14
188 0.23
189 0.23
190 0.25
191 0.27
192 0.31
193 0.3
194 0.36
195 0.38
196 0.35
197 0.4
198 0.38
199 0.43
200 0.43
201 0.49
202 0.45
203 0.44
204 0.42
205 0.37
206 0.39
207 0.37
208 0.38
209 0.33
210 0.34
211 0.33
212 0.31
213 0.3
214 0.26
215 0.22
216 0.16
217 0.14
218 0.1
219 0.11
220 0.11
221 0.11
222 0.13
223 0.15
224 0.16
225 0.18
226 0.18
227 0.18
228 0.22
229 0.25
230 0.24
231 0.22
232 0.23
233 0.22
234 0.21
235 0.2
236 0.17
237 0.15
238 0.14
239 0.14
240 0.15
241 0.17
242 0.18
243 0.19
244 0.23
245 0.25
246 0.26
247 0.28
248 0.3
249 0.3
250 0.38
251 0.39
252 0.4
253 0.44
254 0.48
255 0.54
256 0.56
257 0.56
258 0.54
259 0.57
260 0.61
261 0.61
262 0.61
263 0.58
264 0.61
265 0.59
266 0.53
267 0.5
268 0.45
269 0.41
270 0.36
271 0.32
272 0.25
273 0.3
274 0.3
275 0.31
276 0.35
277 0.35
278 0.39
279 0.47
280 0.49
281 0.49
282 0.54
283 0.59
284 0.54
285 0.52
286 0.51
287 0.51
288 0.52
289 0.51
290 0.52
291 0.49
292 0.46
293 0.5
294 0.5
295 0.52
296 0.56
297 0.53
298 0.5
299 0.52
300 0.56
301 0.58
302 0.61
303 0.57
304 0.52
305 0.51
306 0.48
307 0.42
308 0.4
309 0.36
310 0.32
311 0.3
312 0.36
313 0.39
314 0.42
315 0.46
316 0.48
317 0.56
318 0.58
319 0.58