Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B9X1

Protein Details
Accession A0A2V1B9X1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-123SQRIDGKAFKKPKKKARPVELHQSQDAHydrophilic
NLS Segment(s)
PositionSequence
103-113KAFKKPKKKAR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.333, mito_nucl 10.666, cyto 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MTMAVKGVVELFKLVKREKVLYQEILAFLVSHDHRTVRIYGYYPVLDGKKTTFYCHPIQSHHFSDQSSHDAAFLLREADSQSSRVGSRDVTPDTSLSQRIDGKAFKKPKKKARPVELHQSQDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.31
5 0.33
6 0.39
7 0.41
8 0.39
9 0.39
10 0.37
11 0.33
12 0.29
13 0.25
14 0.17
15 0.12
16 0.15
17 0.13
18 0.13
19 0.13
20 0.13
21 0.14
22 0.16
23 0.18
24 0.15
25 0.16
26 0.16
27 0.17
28 0.19
29 0.18
30 0.17
31 0.18
32 0.17
33 0.15
34 0.14
35 0.13
36 0.18
37 0.18
38 0.2
39 0.2
40 0.24
41 0.28
42 0.32
43 0.33
44 0.29
45 0.34
46 0.36
47 0.36
48 0.34
49 0.31
50 0.26
51 0.26
52 0.24
53 0.23
54 0.18
55 0.15
56 0.12
57 0.12
58 0.12
59 0.1
60 0.08
61 0.06
62 0.05
63 0.05
64 0.06
65 0.08
66 0.09
67 0.09
68 0.1
69 0.11
70 0.11
71 0.12
72 0.12
73 0.11
74 0.13
75 0.17
76 0.19
77 0.19
78 0.2
79 0.2
80 0.22
81 0.23
82 0.23
83 0.19
84 0.21
85 0.21
86 0.22
87 0.25
88 0.28
89 0.28
90 0.35
91 0.44
92 0.5
93 0.57
94 0.65
95 0.73
96 0.79
97 0.87
98 0.88
99 0.89
100 0.91
101 0.89
102 0.9
103 0.88
104 0.82