Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BRI7

Protein Details
Accession A0A2V1BRI7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-52FSKIDRKHQFRLERKYKRRAKLKWARPRWTKFVBasic
NLS Segment(s)
PositionSequence
25-48RKHQFRLERKYKRRAKLKWARPRW
Subcellular Location(s) plas 16, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences IPFDIYTNPYKATRLWPPDFSKIDRKHQFRLERKYKRRAKLKWARPRWTKFVKVAQMGSIVFIAVYGVLFLDWNSQGNPEHKPFEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.46
4 0.5
5 0.57
6 0.59
7 0.57
8 0.58
9 0.55
10 0.61
11 0.63
12 0.62
13 0.61
14 0.65
15 0.71
16 0.7
17 0.75
18 0.75
19 0.77
20 0.81
21 0.84
22 0.85
23 0.84
24 0.84
25 0.8
26 0.8
27 0.79
28 0.81
29 0.82
30 0.82
31 0.83
32 0.82
33 0.81
34 0.78
35 0.75
36 0.69
37 0.64
38 0.62
39 0.59
40 0.53
41 0.48
42 0.4
43 0.35
44 0.3
45 0.25
46 0.18
47 0.11
48 0.08
49 0.07
50 0.06
51 0.03
52 0.03
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.06
59 0.07
60 0.09
61 0.09
62 0.11
63 0.15
64 0.18
65 0.24
66 0.26
67 0.29