Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B2C1

Protein Details
Accession A0A2V1B2C1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-92GAEGPVFGKKKKKKKKPTGRHSNKPYSECSBasic
NLS Segment(s)
PositionSequence
57-83KSGSSRGAEGPVFGKKKKKKKKPTGRH
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MTQIAERRSESDAVRRHPRPSSHSPYHCHGCHDRRGSYPHLSIALRRPRTSPSPSLKSGSSRGAEGPVFGKKKKKKKKPTGRHSNKPYSECSRSYFFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.52
4 0.55
5 0.58
6 0.57
7 0.6
8 0.62
9 0.62
10 0.65
11 0.65
12 0.65
13 0.67
14 0.6
15 0.56
16 0.54
17 0.5
18 0.53
19 0.53
20 0.49
21 0.45
22 0.48
23 0.48
24 0.44
25 0.4
26 0.32
27 0.3
28 0.28
29 0.26
30 0.3
31 0.35
32 0.32
33 0.32
34 0.32
35 0.32
36 0.37
37 0.4
38 0.39
39 0.38
40 0.41
41 0.42
42 0.43
43 0.41
44 0.39
45 0.37
46 0.34
47 0.27
48 0.22
49 0.21
50 0.21
51 0.2
52 0.17
53 0.17
54 0.19
55 0.21
56 0.23
57 0.32
58 0.39
59 0.5
60 0.6
61 0.69
62 0.74
63 0.82
64 0.91
65 0.93
66 0.95
67 0.96
68 0.96
69 0.96
70 0.94
71 0.94
72 0.9
73 0.82
74 0.78
75 0.75
76 0.7
77 0.62
78 0.57
79 0.51