Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B4N5

Protein Details
Accession A0A2V1B4N5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
52-72FKPFYKKISIRRDKLANKRTNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences INKRKIINMPFFLLELGNHDLILSRIWLEYFKILPDITSKALIWPKELPESFKPFYKKISIRRDKLANKRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.17
4 0.14
5 0.13
6 0.12
7 0.12
8 0.12
9 0.12
10 0.08
11 0.06
12 0.06
13 0.06
14 0.07
15 0.07
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.11
25 0.11
26 0.11
27 0.13
28 0.17
29 0.17
30 0.18
31 0.18
32 0.19
33 0.24
34 0.25
35 0.27
36 0.29
37 0.36
38 0.36
39 0.39
40 0.42
41 0.37
42 0.41
43 0.45
44 0.47
45 0.5
46 0.59
47 0.64
48 0.65
49 0.71
50 0.77
51 0.78
52 0.81