Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NFY8

Protein Details
Accession A8NFY8    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAKRRKNRTHLKGGQRDEGKBasic
330-364AIAEKERLRKQRREEQERNVARKKKSANKKGDDDABasic
NLS Segment(s)
PositionSequence
4-9RRKNRT
319-359KTKKEIAEQKAAIAEKERLRKQRREEQERNVARKKKSANKK
421-432PPAKKPRFHRKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR045112  PPAN-like  
Gene Ontology GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
KEGG cci:CC1G_05133  -  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MAKRRKNRTHLKGGQRDEGKSSAPKSFIIKHGHVGSSITQLVRDMRKVMEPNTASRLKERNRNKLKDYMTMGPALQVTHLLAFRLTPIAPSLRIVRLSDGPTLSFRVERYSLMKDVLNTARRAKSIGMEYLTPPLLVLASFPQPGPGTPPHLPLVMKAFQSLFPPLSPHTISLSSARRVVLISYNEERGTIDFRHYLIRVKAHGVSKRVRRVVESATSSSKPVINLGKEKDVADFLLRRRGDPGPDGGYESASSAESAVEDGDMVSLASDYVGRNNKKGTKRAVKLEEVGPRMELRLVKITEGVPGKEGNVIYHEFVKKTKKEIAEQKAAIAEKERLRKQRREEQERNVARKKKSANKKGDDDASSDDEGSVEDESGGEGDVEHEVDDIGEWDEEEEISEGEESEDEQDLSEEDSSDEDKPPAKKPRFHRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.79
3 0.71
4 0.64
5 0.57
6 0.5
7 0.46
8 0.44
9 0.4
10 0.36
11 0.36
12 0.37
13 0.4
14 0.44
15 0.46
16 0.44
17 0.46
18 0.49
19 0.47
20 0.43
21 0.39
22 0.33
23 0.3
24 0.3
25 0.23
26 0.19
27 0.19
28 0.25
29 0.26
30 0.27
31 0.24
32 0.23
33 0.3
34 0.34
35 0.34
36 0.38
37 0.36
38 0.38
39 0.43
40 0.46
41 0.4
42 0.42
43 0.49
44 0.46
45 0.54
46 0.6
47 0.63
48 0.7
49 0.77
50 0.76
51 0.75
52 0.73
53 0.71
54 0.67
55 0.62
56 0.54
57 0.48
58 0.42
59 0.35
60 0.31
61 0.23
62 0.18
63 0.12
64 0.1
65 0.11
66 0.11
67 0.1
68 0.09
69 0.09
70 0.1
71 0.11
72 0.11
73 0.09
74 0.11
75 0.13
76 0.13
77 0.15
78 0.18
79 0.19
80 0.21
81 0.22
82 0.22
83 0.25
84 0.27
85 0.28
86 0.25
87 0.23
88 0.22
89 0.24
90 0.22
91 0.19
92 0.17
93 0.18
94 0.18
95 0.19
96 0.22
97 0.24
98 0.24
99 0.25
100 0.25
101 0.21
102 0.26
103 0.31
104 0.31
105 0.29
106 0.33
107 0.34
108 0.33
109 0.35
110 0.29
111 0.27
112 0.26
113 0.28
114 0.24
115 0.22
116 0.23
117 0.24
118 0.23
119 0.18
120 0.14
121 0.11
122 0.09
123 0.07
124 0.07
125 0.06
126 0.08
127 0.09
128 0.09
129 0.11
130 0.11
131 0.12
132 0.16
133 0.16
134 0.2
135 0.21
136 0.24
137 0.23
138 0.25
139 0.25
140 0.21
141 0.25
142 0.22
143 0.21
144 0.18
145 0.18
146 0.17
147 0.19
148 0.19
149 0.15
150 0.11
151 0.13
152 0.13
153 0.16
154 0.16
155 0.15
156 0.16
157 0.16
158 0.17
159 0.2
160 0.23
161 0.21
162 0.22
163 0.21
164 0.19
165 0.18
166 0.18
167 0.18
168 0.16
169 0.19
170 0.19
171 0.2
172 0.2
173 0.2
174 0.19
175 0.15
176 0.16
177 0.12
178 0.12
179 0.12
180 0.13
181 0.15
182 0.16
183 0.19
184 0.18
185 0.2
186 0.19
187 0.2
188 0.24
189 0.26
190 0.29
191 0.3
192 0.34
193 0.39
194 0.45
195 0.46
196 0.42
197 0.39
198 0.39
199 0.38
200 0.37
201 0.33
202 0.28
203 0.27
204 0.27
205 0.26
206 0.23
207 0.21
208 0.15
209 0.16
210 0.17
211 0.16
212 0.2
213 0.22
214 0.24
215 0.24
216 0.24
217 0.21
218 0.18
219 0.16
220 0.14
221 0.15
222 0.13
223 0.2
224 0.2
225 0.2
226 0.23
227 0.24
228 0.24
229 0.22
230 0.24
231 0.19
232 0.2
233 0.21
234 0.18
235 0.16
236 0.15
237 0.13
238 0.1
239 0.07
240 0.07
241 0.06
242 0.05
243 0.05
244 0.05
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.04
257 0.04
258 0.09
259 0.17
260 0.18
261 0.2
262 0.25
263 0.33
264 0.38
265 0.44
266 0.49
267 0.52
268 0.57
269 0.65
270 0.65
271 0.61
272 0.58
273 0.58
274 0.54
275 0.46
276 0.41
277 0.32
278 0.27
279 0.24
280 0.23
281 0.18
282 0.14
283 0.19
284 0.19
285 0.19
286 0.2
287 0.2
288 0.23
289 0.24
290 0.22
291 0.16
292 0.16
293 0.16
294 0.17
295 0.17
296 0.13
297 0.13
298 0.14
299 0.14
300 0.2
301 0.21
302 0.19
303 0.23
304 0.31
305 0.31
306 0.34
307 0.4
308 0.38
309 0.46
310 0.55
311 0.59
312 0.6
313 0.58
314 0.54
315 0.52
316 0.48
317 0.4
318 0.33
319 0.3
320 0.27
321 0.36
322 0.41
323 0.47
324 0.54
325 0.62
326 0.68
327 0.72
328 0.77
329 0.79
330 0.81
331 0.8
332 0.83
333 0.84
334 0.84
335 0.83
336 0.8
337 0.72
338 0.72
339 0.71
340 0.71
341 0.73
342 0.75
343 0.76
344 0.77
345 0.8
346 0.8
347 0.78
348 0.69
349 0.61
350 0.55
351 0.49
352 0.41
353 0.34
354 0.27
355 0.2
356 0.18
357 0.16
358 0.11
359 0.07
360 0.06
361 0.06
362 0.06
363 0.06
364 0.06
365 0.05
366 0.04
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.06
374 0.06
375 0.06
376 0.07
377 0.06
378 0.06
379 0.07
380 0.07
381 0.07
382 0.08
383 0.08
384 0.07
385 0.07
386 0.08
387 0.07
388 0.07
389 0.08
390 0.07
391 0.09
392 0.1
393 0.09
394 0.09
395 0.1
396 0.1
397 0.11
398 0.11
399 0.1
400 0.09
401 0.11
402 0.13
403 0.15
404 0.16
405 0.17
406 0.22
407 0.25
408 0.34
409 0.43
410 0.5
411 0.56
412 0.64