Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BPU0

Protein Details
Accession A0A2V1BPU0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
148-171EEKVEQKEKKIEKKPLTPNKAGQRBasic
NLS Segment(s)
PositionSequence
155-164EKKIEKKPLT
Subcellular Location(s) mito 17.5, mito_nucl 13, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPSLKKFLSPSSSAPSPSASVSEITKTKTTTSPNGTKTITRTTKATTTNTITKKTKPESTESQLTSKEGAEIEITGPGSNPKTNKIWMGDEVPVMGRGMVTAIVGEDQLTTEELAKMGLVPQGRWVKVGTTKTVKKTVTRVERKVVQEEKVEQKEKKIEKKPLTPNKAGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.3
4 0.27
5 0.24
6 0.18
7 0.16
8 0.16
9 0.2
10 0.2
11 0.22
12 0.24
13 0.23
14 0.25
15 0.28
16 0.32
17 0.35
18 0.41
19 0.46
20 0.46
21 0.5
22 0.49
23 0.47
24 0.45
25 0.48
26 0.44
27 0.38
28 0.37
29 0.36
30 0.41
31 0.42
32 0.41
33 0.36
34 0.37
35 0.44
36 0.45
37 0.48
38 0.45
39 0.45
40 0.49
41 0.49
42 0.5
43 0.44
44 0.47
45 0.48
46 0.51
47 0.54
48 0.48
49 0.46
50 0.41
51 0.38
52 0.33
53 0.25
54 0.2
55 0.13
56 0.11
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.08
66 0.1
67 0.1
68 0.12
69 0.14
70 0.15
71 0.18
72 0.19
73 0.19
74 0.19
75 0.21
76 0.18
77 0.16
78 0.15
79 0.13
80 0.11
81 0.09
82 0.07
83 0.05
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.06
105 0.08
106 0.07
107 0.07
108 0.15
109 0.2
110 0.21
111 0.22
112 0.21
113 0.22
114 0.28
115 0.31
116 0.3
117 0.34
118 0.4
119 0.44
120 0.51
121 0.5
122 0.48
123 0.52
124 0.56
125 0.58
126 0.62
127 0.62
128 0.62
129 0.68
130 0.67
131 0.69
132 0.63
133 0.56
134 0.52
135 0.54
136 0.56
137 0.57
138 0.6
139 0.52
140 0.54
141 0.6
142 0.63
143 0.67
144 0.66
145 0.69
146 0.71
147 0.8
148 0.84
149 0.86
150 0.86
151 0.83