Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PE29

Protein Details
Accession A8PE29    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-125YVGAPNRKPRTKKAARRKINVSYASRHydrophilic
NLS Segment(s)
PositionSequence
105-117NRKPRTKKAARRK
Subcellular Location(s) cysk 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
KEGG cci:CC1G_09765  -  
Pfam View protein in Pfam  
PF00071  Ras  
Amino Acid Sequences MTLPSGIWGFGELTEFVMGMFVEIYDPTIEDAYQRQMVLDGQMCFVEVIDTAGQADRKHDREVSREEGRAMARSFSCDFLETSAKLEKTSSGHLLMSSAYVGAPNRKPRTKKAARRKINVSYASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.07
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.06
15 0.07
16 0.07
17 0.07
18 0.09
19 0.12
20 0.13
21 0.13
22 0.12
23 0.12
24 0.13
25 0.14
26 0.16
27 0.13
28 0.12
29 0.12
30 0.12
31 0.11
32 0.1
33 0.08
34 0.05
35 0.06
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.07
42 0.1
43 0.13
44 0.16
45 0.18
46 0.21
47 0.22
48 0.25
49 0.3
50 0.34
51 0.33
52 0.31
53 0.3
54 0.28
55 0.27
56 0.26
57 0.21
58 0.17
59 0.14
60 0.16
61 0.17
62 0.16
63 0.16
64 0.14
65 0.14
66 0.14
67 0.17
68 0.14
69 0.15
70 0.18
71 0.17
72 0.17
73 0.17
74 0.17
75 0.16
76 0.2
77 0.2
78 0.17
79 0.17
80 0.17
81 0.17
82 0.15
83 0.13
84 0.09
85 0.07
86 0.05
87 0.07
88 0.08
89 0.14
90 0.2
91 0.29
92 0.38
93 0.46
94 0.51
95 0.58
96 0.68
97 0.73
98 0.78
99 0.8
100 0.83
101 0.85
102 0.89
103 0.89
104 0.87
105 0.85