Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1CEG9

Protein Details
Accession A0A2V1CEG9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-75LTSPKLTCPEPKPKPKPKPKPKPMPMPMPVRHydrophilic
NLS Segment(s)
PositionSequence
55-79PKPKPKPKPKPKPMPMPMPVRPKKP
Subcellular Location(s) mito 10, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MQGSEIQGRTGGGRVGQSWAAPGRAKGRASGEIILSTFVRFACLLTSPKLTCPEPKPKPKPKPKPKPMPMPMPVRPKKPDPFRIGVTTITSPASGGHKLVAGVLVPGWLPLAQGLELGDRGHTTKPDDGQGQRTRREVESASERTLNDPSELGRGQRAEGRYEHGRPGDSGSLLAVKGYGRKRQNLAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.15
5 0.17
6 0.18
7 0.2
8 0.19
9 0.21
10 0.23
11 0.28
12 0.29
13 0.29
14 0.32
15 0.33
16 0.34
17 0.34
18 0.29
19 0.25
20 0.24
21 0.22
22 0.18
23 0.14
24 0.12
25 0.1
26 0.1
27 0.09
28 0.09
29 0.08
30 0.12
31 0.14
32 0.15
33 0.2
34 0.19
35 0.22
36 0.27
37 0.27
38 0.3
39 0.35
40 0.43
41 0.48
42 0.59
43 0.66
44 0.73
45 0.82
46 0.86
47 0.91
48 0.92
49 0.94
50 0.93
51 0.94
52 0.92
53 0.92
54 0.88
55 0.86
56 0.81
57 0.78
58 0.74
59 0.74
60 0.69
61 0.64
62 0.61
63 0.58
64 0.6
65 0.61
66 0.62
67 0.58
68 0.58
69 0.55
70 0.54
71 0.49
72 0.41
73 0.35
74 0.26
75 0.21
76 0.16
77 0.13
78 0.1
79 0.09
80 0.1
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.05
89 0.04
90 0.04
91 0.04
92 0.03
93 0.03
94 0.04
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.05
106 0.05
107 0.07
108 0.08
109 0.09
110 0.11
111 0.14
112 0.16
113 0.19
114 0.23
115 0.24
116 0.32
117 0.39
118 0.42
119 0.42
120 0.44
121 0.44
122 0.4
123 0.41
124 0.34
125 0.31
126 0.35
127 0.35
128 0.34
129 0.34
130 0.33
131 0.31
132 0.32
133 0.27
134 0.2
135 0.17
136 0.15
137 0.17
138 0.18
139 0.17
140 0.18
141 0.18
142 0.19
143 0.23
144 0.24
145 0.22
146 0.23
147 0.28
148 0.31
149 0.33
150 0.37
151 0.34
152 0.34
153 0.32
154 0.35
155 0.32
156 0.26
157 0.24
158 0.2
159 0.19
160 0.17
161 0.16
162 0.12
163 0.1
164 0.16
165 0.22
166 0.29
167 0.34
168 0.41