Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BD09

Protein Details
Accession A0A2V1BD09    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
140-182QSLVNKPPRRAPRKRNAQQLERLRKYRRAYQRQWRQNRKGGVYHydrophilic
212-239QGYWHKRQESRMKIKKETWKREHCRGEQBasic
NLS Segment(s)
PositionSequence
145-168KPPRRAPRKRNAQQLERLRKYRRA
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAKSTYCLPTEILFVSKSFDMPVSTSLFPGQRDLVGSIYLLKPLRHNLRPRPAGSAGSVVARQPQEGDETDDTEESDQSDQNYQSDDETDDEKSEEYKGEDEEEDEEEDEEEENILGDGEQRSDVESHQSRLQSHLAKGQSLVNKPPRRAPRKRNAQQLERLRKYRRAYQRQWRQNRKGGVYLPIYVDNFVAHTLPHTTPEPWRAKSYAQEQGYWHKRQESRMKIKKETWKREHCRGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.17
5 0.15
6 0.14
7 0.13
8 0.14
9 0.17
10 0.18
11 0.18
12 0.18
13 0.21
14 0.22
15 0.21
16 0.22
17 0.21
18 0.17
19 0.18
20 0.19
21 0.17
22 0.15
23 0.14
24 0.14
25 0.14
26 0.17
27 0.17
28 0.16
29 0.18
30 0.26
31 0.34
32 0.39
33 0.47
34 0.53
35 0.62
36 0.68
37 0.66
38 0.65
39 0.59
40 0.53
41 0.46
42 0.39
43 0.29
44 0.24
45 0.23
46 0.16
47 0.18
48 0.17
49 0.15
50 0.13
51 0.13
52 0.14
53 0.15
54 0.2
55 0.16
56 0.18
57 0.19
58 0.18
59 0.17
60 0.15
61 0.14
62 0.1
63 0.1
64 0.09
65 0.09
66 0.12
67 0.12
68 0.12
69 0.14
70 0.13
71 0.12
72 0.12
73 0.12
74 0.1
75 0.12
76 0.12
77 0.11
78 0.11
79 0.1
80 0.1
81 0.1
82 0.09
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.1
92 0.09
93 0.09
94 0.08
95 0.08
96 0.07
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.12
113 0.13
114 0.15
115 0.18
116 0.19
117 0.19
118 0.21
119 0.26
120 0.22
121 0.22
122 0.26
123 0.23
124 0.22
125 0.23
126 0.24
127 0.24
128 0.23
129 0.29
130 0.33
131 0.37
132 0.38
133 0.46
134 0.52
135 0.57
136 0.65
137 0.68
138 0.69
139 0.76
140 0.83
141 0.86
142 0.83
143 0.81
144 0.81
145 0.81
146 0.82
147 0.77
148 0.76
149 0.7
150 0.7
151 0.67
152 0.67
153 0.67
154 0.67
155 0.7
156 0.74
157 0.8
158 0.83
159 0.9
160 0.91
161 0.88
162 0.86
163 0.83
164 0.76
165 0.71
166 0.63
167 0.58
168 0.5
169 0.43
170 0.37
171 0.33
172 0.3
173 0.24
174 0.22
175 0.15
176 0.13
177 0.12
178 0.1
179 0.06
180 0.07
181 0.11
182 0.11
183 0.14
184 0.16
185 0.17
186 0.22
187 0.31
188 0.37
189 0.36
190 0.4
191 0.39
192 0.4
193 0.46
194 0.49
195 0.49
196 0.44
197 0.44
198 0.42
199 0.51
200 0.56
201 0.52
202 0.48
203 0.48
204 0.49
205 0.56
206 0.64
207 0.64
208 0.67
209 0.73
210 0.78
211 0.77
212 0.82
213 0.84
214 0.84
215 0.84
216 0.84
217 0.85
218 0.85
219 0.88