Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B7X1

Protein Details
Accession A0A2V1B7X1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-131EGAFAASKRKERRRRRRRAVSILLVLTHydrophilic
NLS Segment(s)
PositionSequence
111-122SKRKERRRRRRR
Subcellular Location(s) mito 9, cyto 8, nucl 6, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MLSGLLGSKPFQFIIGPSGPDRKLCTIHTAVVESLSGPLAVMMNGSMHEAIDGVATLEDVDEQTFVRFCEYAYMGDYTPAQQQHVLASFNFDGGESPTPMRDHMEGAFAASKRKERRRRRRRAVSILLVLTTLKYCVDNADNAVLEYLRRSSGTSSNDAGTRWSVQSFDQTNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.21
4 0.22
5 0.28
6 0.28
7 0.29
8 0.32
9 0.3
10 0.3
11 0.3
12 0.34
13 0.31
14 0.33
15 0.33
16 0.31
17 0.27
18 0.24
19 0.22
20 0.15
21 0.13
22 0.1
23 0.08
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.07
54 0.06
55 0.06
56 0.09
57 0.1
58 0.1
59 0.11
60 0.13
61 0.11
62 0.12
63 0.12
64 0.1
65 0.12
66 0.12
67 0.11
68 0.1
69 0.1
70 0.1
71 0.12
72 0.11
73 0.08
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.07
80 0.08
81 0.09
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.12
88 0.1
89 0.11
90 0.1
91 0.12
92 0.1
93 0.11
94 0.14
95 0.13
96 0.15
97 0.15
98 0.21
99 0.28
100 0.38
101 0.48
102 0.56
103 0.67
104 0.76
105 0.86
106 0.91
107 0.94
108 0.94
109 0.94
110 0.91
111 0.87
112 0.81
113 0.7
114 0.59
115 0.47
116 0.37
117 0.27
118 0.18
119 0.12
120 0.07
121 0.07
122 0.07
123 0.09
124 0.11
125 0.12
126 0.14
127 0.16
128 0.16
129 0.15
130 0.16
131 0.13
132 0.11
133 0.11
134 0.11
135 0.09
136 0.09
137 0.11
138 0.14
139 0.2
140 0.25
141 0.27
142 0.28
143 0.3
144 0.31
145 0.3
146 0.29
147 0.25
148 0.23
149 0.21
150 0.19
151 0.18
152 0.18
153 0.27