Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CV03

Protein Details
Accession A0A2V1CV03   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-64LWSWYKKSSRRTIITNKVKKAHydrophilic
314-338GFYCDCPKCPPPRVAKKQAKVLRGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd20071  SET_SMYD  
Amino Acid Sequences MADKTTTSADTVAGQEPDKMFPMLTVESGSLADDFDKWMEVRMLWSWYKKSSRRTIITNKVKKAGGEGSHEKPSEPPAPRISEERHQYLHNYIPPSPTPSSSNSSILSGISDSTPPTSASPSLATSFSATFCASTQPQLPSLLSPNSPSDITPTIIQPPSNTQALFSSEYFEVRRSKKGGYGAFATKDIETETIIMVEKPLFRANFMEVFVELEKLTREQRREYRTLHGYTGLSPTKDLAIYKTNRFETSGGKGGIFIKSSRFNHACHPFATCSYRYDEAAEMIVFTACNPIKKDQEITISYTTNPCQLMDNYGFYCDCPKCPPPRVAKKQAKVLRGPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.22
4 0.23
5 0.23
6 0.2
7 0.17
8 0.15
9 0.19
10 0.16
11 0.15
12 0.15
13 0.13
14 0.13
15 0.13
16 0.13
17 0.1
18 0.09
19 0.09
20 0.08
21 0.09
22 0.08
23 0.1
24 0.09
25 0.12
26 0.13
27 0.12
28 0.14
29 0.16
30 0.2
31 0.22
32 0.27
33 0.28
34 0.34
35 0.43
36 0.47
37 0.54
38 0.59
39 0.65
40 0.66
41 0.72
42 0.75
43 0.77
44 0.81
45 0.81
46 0.76
47 0.72
48 0.68
49 0.58
50 0.53
51 0.49
52 0.42
53 0.41
54 0.42
55 0.41
56 0.46
57 0.46
58 0.41
59 0.35
60 0.37
61 0.37
62 0.35
63 0.36
64 0.35
65 0.39
66 0.41
67 0.44
68 0.44
69 0.44
70 0.46
71 0.45
72 0.41
73 0.38
74 0.38
75 0.37
76 0.38
77 0.34
78 0.32
79 0.29
80 0.3
81 0.3
82 0.33
83 0.31
84 0.27
85 0.26
86 0.27
87 0.3
88 0.3
89 0.31
90 0.26
91 0.26
92 0.24
93 0.21
94 0.18
95 0.13
96 0.1
97 0.08
98 0.08
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.11
105 0.11
106 0.12
107 0.13
108 0.13
109 0.14
110 0.13
111 0.13
112 0.12
113 0.12
114 0.11
115 0.11
116 0.1
117 0.09
118 0.09
119 0.11
120 0.1
121 0.12
122 0.14
123 0.14
124 0.16
125 0.16
126 0.16
127 0.14
128 0.17
129 0.17
130 0.14
131 0.15
132 0.15
133 0.15
134 0.15
135 0.14
136 0.14
137 0.14
138 0.14
139 0.13
140 0.13
141 0.16
142 0.16
143 0.16
144 0.14
145 0.16
146 0.17
147 0.18
148 0.17
149 0.13
150 0.14
151 0.16
152 0.18
153 0.14
154 0.14
155 0.13
156 0.14
157 0.14
158 0.16
159 0.18
160 0.18
161 0.22
162 0.21
163 0.22
164 0.25
165 0.3
166 0.3
167 0.26
168 0.28
169 0.27
170 0.26
171 0.26
172 0.23
173 0.17
174 0.15
175 0.13
176 0.1
177 0.08
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.08
187 0.11
188 0.11
189 0.11
190 0.13
191 0.14
192 0.15
193 0.15
194 0.14
195 0.11
196 0.13
197 0.12
198 0.12
199 0.09
200 0.08
201 0.08
202 0.09
203 0.14
204 0.17
205 0.2
206 0.26
207 0.34
208 0.41
209 0.45
210 0.47
211 0.5
212 0.52
213 0.52
214 0.46
215 0.41
216 0.35
217 0.31
218 0.34
219 0.28
220 0.22
221 0.19
222 0.19
223 0.17
224 0.17
225 0.16
226 0.13
227 0.19
228 0.23
229 0.27
230 0.33
231 0.34
232 0.34
233 0.36
234 0.34
235 0.3
236 0.32
237 0.34
238 0.28
239 0.26
240 0.26
241 0.26
242 0.26
243 0.23
244 0.18
245 0.16
246 0.24
247 0.25
248 0.33
249 0.33
250 0.33
251 0.41
252 0.48
253 0.46
254 0.38
255 0.42
256 0.35
257 0.37
258 0.4
259 0.32
260 0.27
261 0.3
262 0.31
263 0.27
264 0.28
265 0.25
266 0.21
267 0.21
268 0.18
269 0.13
270 0.12
271 0.11
272 0.09
273 0.08
274 0.14
275 0.14
276 0.17
277 0.2
278 0.25
279 0.3
280 0.33
281 0.37
282 0.34
283 0.4
284 0.39
285 0.42
286 0.4
287 0.37
288 0.35
289 0.35
290 0.32
291 0.28
292 0.26
293 0.21
294 0.22
295 0.21
296 0.27
297 0.26
298 0.29
299 0.26
300 0.28
301 0.27
302 0.24
303 0.31
304 0.25
305 0.25
306 0.28
307 0.35
308 0.42
309 0.49
310 0.57
311 0.61
312 0.71
313 0.78
314 0.82
315 0.86
316 0.85
317 0.88
318 0.87
319 0.84