Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BW16

Protein Details
Accession A0A2V1BW16    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-40GGPNTPKTPRSNRTRSQNPNPPSHydrophilic
NLS Segment(s)
PositionSequence
183-189KRRRKSR
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, mito 5, cyto 3.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNPPPAPPTTPPAQAATGGPNTPKTPRSNRTRSQNPNPPSLDIEPENKQLFPASEYHALPFPLGLQAAGPGNPFGGPAAGHHHVPPPLPPGLLALIPPPPTTAKPLPAVAAPVALAPVAVPVAPATQQSTTAVAAPPSTTSLLAPATQNLGSSATTQSSNTVLGPRQRSGSSSSVEDEPAATKRRRKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.29
4 0.27
5 0.24
6 0.24
7 0.23
8 0.24
9 0.27
10 0.31
11 0.33
12 0.4
13 0.48
14 0.56
15 0.63
16 0.69
17 0.76
18 0.81
19 0.83
20 0.84
21 0.85
22 0.79
23 0.78
24 0.72
25 0.63
26 0.58
27 0.49
28 0.43
29 0.36
30 0.37
31 0.31
32 0.35
33 0.34
34 0.28
35 0.27
36 0.23
37 0.22
38 0.19
39 0.17
40 0.16
41 0.2
42 0.2
43 0.21
44 0.21
45 0.21
46 0.19
47 0.16
48 0.12
49 0.09
50 0.08
51 0.07
52 0.05
53 0.06
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.05
65 0.1
66 0.11
67 0.12
68 0.12
69 0.14
70 0.15
71 0.15
72 0.16
73 0.13
74 0.13
75 0.12
76 0.12
77 0.11
78 0.11
79 0.1
80 0.09
81 0.07
82 0.08
83 0.09
84 0.09
85 0.09
86 0.09
87 0.1
88 0.15
89 0.16
90 0.17
91 0.19
92 0.19
93 0.19
94 0.18
95 0.19
96 0.13
97 0.12
98 0.09
99 0.06
100 0.06
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.07
113 0.07
114 0.08
115 0.09
116 0.1
117 0.1
118 0.11
119 0.11
120 0.1
121 0.1
122 0.09
123 0.09
124 0.09
125 0.1
126 0.09
127 0.08
128 0.1
129 0.1
130 0.11
131 0.11
132 0.1
133 0.12
134 0.12
135 0.12
136 0.11
137 0.12
138 0.11
139 0.12
140 0.13
141 0.12
142 0.13
143 0.13
144 0.13
145 0.13
146 0.13
147 0.13
148 0.15
149 0.17
150 0.24
151 0.28
152 0.29
153 0.31
154 0.31
155 0.32
156 0.34
157 0.34
158 0.3
159 0.28
160 0.29
161 0.27
162 0.27
163 0.26
164 0.21
165 0.2
166 0.22
167 0.26
168 0.29
169 0.35