Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B8R2

Protein Details
Accession A0A2V1B8R2    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
147-168GGEKRVVRVKWKRMEQNSEENLHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 19, mito 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024311  Lipocalin-like  
Pfam View protein in Pfam  
PF13924  Lipocalin_5  
Amino Acid Sequences MASNTSIRTQLIGAWELISYCAYKVDDPSERIFPLGPEAQGMIMYTPSGHMSAQLRRPGQPHFATGDGITSGTDSEWAEVGRNYVAYTGCFFLDETGGSEGEPMLLHEMRYSNIPRLVGDVQRRLVEIKDESDGRYLYLGVKEIFLGGEKRVVRVKWKRMEQNSEENLPVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.14
5 0.12
6 0.09
7 0.08
8 0.1
9 0.11
10 0.11
11 0.14
12 0.19
13 0.24
14 0.26
15 0.3
16 0.31
17 0.3
18 0.3
19 0.28
20 0.22
21 0.22
22 0.21
23 0.17
24 0.14
25 0.14
26 0.14
27 0.13
28 0.13
29 0.08
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.09
38 0.12
39 0.18
40 0.24
41 0.29
42 0.3
43 0.31
44 0.33
45 0.33
46 0.37
47 0.33
48 0.29
49 0.26
50 0.25
51 0.24
52 0.22
53 0.19
54 0.12
55 0.11
56 0.08
57 0.06
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.06
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.04
91 0.06
92 0.07
93 0.07
94 0.08
95 0.09
96 0.09
97 0.12
98 0.14
99 0.14
100 0.16
101 0.17
102 0.16
103 0.19
104 0.22
105 0.24
106 0.27
107 0.28
108 0.28
109 0.28
110 0.29
111 0.26
112 0.24
113 0.23
114 0.19
115 0.17
116 0.18
117 0.19
118 0.19
119 0.21
120 0.21
121 0.17
122 0.16
123 0.14
124 0.13
125 0.13
126 0.14
127 0.12
128 0.12
129 0.12
130 0.11
131 0.11
132 0.11
133 0.11
134 0.09
135 0.15
136 0.15
137 0.18
138 0.23
139 0.25
140 0.33
141 0.42
142 0.51
143 0.55
144 0.64
145 0.72
146 0.75
147 0.84
148 0.8
149 0.81
150 0.77
151 0.71
152 0.64