Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CTY4

Protein Details
Accession A0A2V1CTY4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-77PSHRHPYHLPQKQKLHKNKTKNSRPRNNSPQPTAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MSPTRSIFLLLSCFHMQCAAMQCSPTFLPFCKPSNFPLPFFPPSHRHPYHLPQKQKLHKNKTKNSRPRNNSPQPTAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.17
5 0.22
6 0.2
7 0.18
8 0.19
9 0.19
10 0.21
11 0.21
12 0.19
13 0.14
14 0.12
15 0.16
16 0.2
17 0.23
18 0.24
19 0.25
20 0.27
21 0.35
22 0.37
23 0.33
24 0.33
25 0.35
26 0.35
27 0.35
28 0.35
29 0.31
30 0.33
31 0.41
32 0.38
33 0.36
34 0.38
35 0.46
36 0.53
37 0.56
38 0.6
39 0.59
40 0.68
41 0.74
42 0.79
43 0.8
44 0.81
45 0.81
46 0.84
47 0.85
48 0.87
49 0.89
50 0.89
51 0.9
52 0.9
53 0.9
54 0.9
55 0.91
56 0.91
57 0.89