Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1B361

Protein Details
Accession A0A2V1B361   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-103LGTGTKERTRQQKKPQDGEEFEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, mito 1, cyto_nucl 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences LISLFNSALTSLSSAVNVFLARSHVSSTSFVSLDITIIAGQVGVVSVNFGFLISRRCATCETPVINVESGVSRQRDRAGVLLGTGTKERTRQQKKPQDGEEFETGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.07
7 0.09
8 0.1
9 0.1
10 0.12
11 0.12
12 0.14
13 0.15
14 0.17
15 0.17
16 0.16
17 0.15
18 0.15
19 0.13
20 0.11
21 0.1
22 0.08
23 0.05
24 0.05
25 0.05
26 0.03
27 0.03
28 0.03
29 0.03
30 0.02
31 0.02
32 0.03
33 0.02
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.07
40 0.08
41 0.09
42 0.09
43 0.11
44 0.13
45 0.15
46 0.18
47 0.2
48 0.21
49 0.21
50 0.22
51 0.22
52 0.2
53 0.18
54 0.15
55 0.11
56 0.11
57 0.12
58 0.14
59 0.13
60 0.14
61 0.17
62 0.18
63 0.18
64 0.19
65 0.18
66 0.16
67 0.16
68 0.16
69 0.14
70 0.14
71 0.14
72 0.13
73 0.13
74 0.16
75 0.22
76 0.31
77 0.41
78 0.49
79 0.6
80 0.68
81 0.77
82 0.83
83 0.85
84 0.84
85 0.79
86 0.75
87 0.69