Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BAM4

Protein Details
Accession A0A2V1BAM4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-101LSDLAMKRRKLKEKIRPIIFVHydrophilic
NLS Segment(s)
PositionSequence
88-93RRKLKE
Subcellular Location(s) cyto_nucl 10.5, cyto 9, nucl 6, mito 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR007751  DUF676_lipase-like  
Pfam View protein in Pfam  
PF05057  DUF676  
Amino Acid Sequences MGTQILHQGEGQIVADVVFVHGLRGDAIKTWSDGVTCWPRDLLQYDVPNTWIITWGYDSNIAKLAEFSSQNSIFGHAENLLSDLAMKRRKLKEKIRPIIFVGHSLGGLVIKEVRFGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.08
14 0.1
15 0.1
16 0.1
17 0.12
18 0.11
19 0.11
20 0.11
21 0.16
22 0.22
23 0.22
24 0.21
25 0.21
26 0.2
27 0.22
28 0.25
29 0.22
30 0.2
31 0.22
32 0.24
33 0.23
34 0.24
35 0.23
36 0.2
37 0.16
38 0.12
39 0.09
40 0.08
41 0.09
42 0.08
43 0.08
44 0.12
45 0.12
46 0.11
47 0.14
48 0.14
49 0.12
50 0.12
51 0.12
52 0.11
53 0.12
54 0.12
55 0.14
56 0.14
57 0.15
58 0.14
59 0.16
60 0.14
61 0.14
62 0.14
63 0.09
64 0.09
65 0.08
66 0.09
67 0.07
68 0.06
69 0.07
70 0.07
71 0.13
72 0.18
73 0.2
74 0.27
75 0.36
76 0.45
77 0.54
78 0.63
79 0.68
80 0.75
81 0.83
82 0.81
83 0.76
84 0.69
85 0.68
86 0.58
87 0.5
88 0.41
89 0.31
90 0.25
91 0.22
92 0.2
93 0.12
94 0.11
95 0.09
96 0.1
97 0.09