Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CQH1

Protein Details
Accession A0A2V1CQH1   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-58KVQVPAKKAKESKKESKAPEKVEHydrophilic
NLS Segment(s)
PositionSequence
40-55PAKKAKESKKESKAPE
74-83TKPTKKSKAN
Subcellular Location(s) nucl 22.5, cyto_nucl 13.833, mito_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MPKRKAKDSGDAEEPRRSSRRISTKFEDVAPEPSAKVQVPAKKAKESKKESKAPEKVEPVVNGKTEEESDSKPTKPTKKSKANTALAKPKPAEEAGPSAGRQYWLLKAEPESRIEKGKDIKFSIDDLAAKTEPEPWDARNNLRAMKKGDLAFFYHSSCKVPAIVGTMKIVQEHTPDLTAHDPSAPYYDASSKPSDPKWSVVHVTFKQKLNTPITLKELKEWQVEKGHPLENMQMLKLTRMSVSKVSEGEWRFLVGEMEKRGDVVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.52
4 0.47
5 0.44
6 0.47
7 0.54
8 0.55
9 0.61
10 0.62
11 0.66
12 0.67
13 0.63
14 0.58
15 0.49
16 0.46
17 0.4
18 0.34
19 0.26
20 0.24
21 0.25
22 0.2
23 0.22
24 0.23
25 0.27
26 0.33
27 0.42
28 0.45
29 0.51
30 0.59
31 0.64
32 0.68
33 0.71
34 0.75
35 0.76
36 0.8
37 0.8
38 0.83
39 0.82
40 0.77
41 0.76
42 0.7
43 0.64
44 0.6
45 0.55
46 0.49
47 0.44
48 0.39
49 0.32
50 0.27
51 0.25
52 0.21
53 0.21
54 0.19
55 0.18
56 0.23
57 0.24
58 0.25
59 0.28
60 0.35
61 0.41
62 0.47
63 0.55
64 0.6
65 0.68
66 0.71
67 0.76
68 0.79
69 0.79
70 0.77
71 0.75
72 0.75
73 0.66
74 0.67
75 0.56
76 0.47
77 0.42
78 0.35
79 0.28
80 0.2
81 0.21
82 0.19
83 0.2
84 0.19
85 0.17
86 0.17
87 0.16
88 0.15
89 0.12
90 0.13
91 0.14
92 0.15
93 0.15
94 0.18
95 0.22
96 0.23
97 0.24
98 0.23
99 0.22
100 0.26
101 0.26
102 0.26
103 0.29
104 0.31
105 0.32
106 0.31
107 0.31
108 0.27
109 0.28
110 0.25
111 0.19
112 0.16
113 0.12
114 0.14
115 0.12
116 0.11
117 0.1
118 0.13
119 0.12
120 0.14
121 0.14
122 0.13
123 0.18
124 0.2
125 0.22
126 0.22
127 0.24
128 0.27
129 0.28
130 0.3
131 0.28
132 0.29
133 0.31
134 0.28
135 0.28
136 0.24
137 0.24
138 0.24
139 0.22
140 0.21
141 0.18
142 0.17
143 0.17
144 0.16
145 0.15
146 0.12
147 0.11
148 0.1
149 0.13
150 0.13
151 0.13
152 0.13
153 0.14
154 0.14
155 0.14
156 0.14
157 0.11
158 0.11
159 0.12
160 0.11
161 0.11
162 0.11
163 0.13
164 0.14
165 0.14
166 0.12
167 0.12
168 0.12
169 0.11
170 0.13
171 0.12
172 0.1
173 0.11
174 0.15
175 0.15
176 0.18
177 0.21
178 0.21
179 0.25
180 0.27
181 0.33
182 0.31
183 0.34
184 0.34
185 0.35
186 0.37
187 0.36
188 0.42
189 0.39
190 0.46
191 0.48
192 0.49
193 0.47
194 0.48
195 0.52
196 0.48
197 0.51
198 0.45
199 0.43
200 0.45
201 0.48
202 0.43
203 0.4
204 0.4
205 0.38
206 0.41
207 0.39
208 0.37
209 0.39
210 0.39
211 0.4
212 0.39
213 0.38
214 0.31
215 0.32
216 0.31
217 0.3
218 0.3
219 0.26
220 0.25
221 0.22
222 0.24
223 0.23
224 0.21
225 0.18
226 0.18
227 0.22
228 0.23
229 0.26
230 0.28
231 0.27
232 0.28
233 0.33
234 0.33
235 0.32
236 0.27
237 0.25
238 0.22
239 0.22
240 0.23
241 0.18
242 0.23
243 0.23
244 0.26
245 0.24
246 0.24