Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1CGZ1

Protein Details
Accession A0A2V1CGZ1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
95-118AETMHRKRVERLKRKEKRNKMLKSBasic
NLS Segment(s)
PositionSequence
55-118AVKAKEKEMKDEKEAARQVKIQAIKDKRAKKEEKARFEKLAETMHRKRVERLKRKEKRNKMLKS
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTEIEVPVESTAAAAPQGMRKNGKQWHEPKTAFRPKAGNGTYEKRQAERVAMAAVKAKEKEMKDEKEAARQVKIQAIKDKRAKKEEKARFEKLAETMHRKRVERLKRKEKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.12
5 0.17
6 0.21
7 0.25
8 0.26
9 0.34
10 0.41
11 0.45
12 0.49
13 0.52
14 0.57
15 0.62
16 0.63
17 0.62
18 0.66
19 0.7
20 0.62
21 0.58
22 0.53
23 0.46
24 0.53
25 0.47
26 0.4
27 0.35
28 0.39
29 0.4
30 0.43
31 0.41
32 0.33
33 0.35
34 0.32
35 0.29
36 0.24
37 0.2
38 0.15
39 0.14
40 0.14
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.16
47 0.17
48 0.24
49 0.27
50 0.3
51 0.31
52 0.39
53 0.39
54 0.42
55 0.46
56 0.4
57 0.35
58 0.33
59 0.32
60 0.29
61 0.32
62 0.28
63 0.33
64 0.36
65 0.42
66 0.48
67 0.55
68 0.57
69 0.63
70 0.64
71 0.65
72 0.71
73 0.73
74 0.75
75 0.76
76 0.75
77 0.7
78 0.66
79 0.6
80 0.52
81 0.5
82 0.46
83 0.47
84 0.47
85 0.51
86 0.56
87 0.54
88 0.59
89 0.61
90 0.66
91 0.68
92 0.73
93 0.76
94 0.79
95 0.89
96 0.92
97 0.93
98 0.93