Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BQ27

Protein Details
Accession A0A2V1BQ27    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-36DSHTSPRRRSGEKKQPPRRYSHDBasic
NLS Segment(s)
PositionSequence
20-30RRRSGEKKQPP
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences SAGYSEKTLQFDADSHTSPRRRSGEKKQPPRRYSHDPSKVNGYTTCGRHGDDWLFGGFSVSGAVKKLWEKDNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.3
4 0.33
5 0.34
6 0.41
7 0.41
8 0.44
9 0.5
10 0.58
11 0.62
12 0.69
13 0.79
14 0.81
15 0.86
16 0.83
17 0.82
18 0.78
19 0.76
20 0.74
21 0.73
22 0.72
23 0.64
24 0.62
25 0.62
26 0.56
27 0.48
28 0.4
29 0.34
30 0.28
31 0.27
32 0.3
33 0.23
34 0.23
35 0.22
36 0.25
37 0.22
38 0.18
39 0.18
40 0.14
41 0.13
42 0.12
43 0.12
44 0.09
45 0.07
46 0.08
47 0.07
48 0.07
49 0.08
50 0.09
51 0.11
52 0.15
53 0.21
54 0.28