Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CSR9

Protein Details
Accession A0A2V1CSR9   
Localization Confidence High
Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-56HPETYKNIHLPRRRKSRKNSKDTYSDYEHydrophilic
283-304KWQDGKKETAKKQEKWENKYGSHydrophilic
307-329ESDGGRSRRSHRSHHRSRRDSYDBasic
NLS Segment(s)
PositionSequence
39-46PRRRKSRK
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
Amino Acid Sequences MEAFVELGLSGADKMIDKHFDKMPDKAFHPETYKNIHLPRRRKSRKNSKDTYSDYESESDRERGTQSMSHQAPPEYKHSTAADPGYSYIPESPRTNTPPFYSREPPHPRPEYMPSQPSSVSANPYYTPPPTAGIPRMAMNRGRDVDPYDDADYHSDSYRAPRRPKAVTRRSSSYHGPRDRDNYGYDQQLARRHGTGSDRLDRYSDRAKDTAHRYKLKDDMNSVFTASKVGLTGGAVGAVVGGWAAQKAQVGYRKDGHKLDPNPLLTLLGATVGGLAVNAAVDKWQDGKKETAKKQEKWENKYGSEDESDGGRSRRSHRSHHRSRRDSYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.2
4 0.21
5 0.25
6 0.3
7 0.38
8 0.41
9 0.45
10 0.49
11 0.48
12 0.49
13 0.53
14 0.52
15 0.49
16 0.51
17 0.5
18 0.47
19 0.49
20 0.5
21 0.49
22 0.53
23 0.56
24 0.6
25 0.64
26 0.69
27 0.73
28 0.8
29 0.83
30 0.87
31 0.89
32 0.91
33 0.92
34 0.91
35 0.87
36 0.86
37 0.83
38 0.79
39 0.74
40 0.65
41 0.56
42 0.5
43 0.43
44 0.36
45 0.33
46 0.27
47 0.21
48 0.21
49 0.2
50 0.19
51 0.21
52 0.21
53 0.21
54 0.29
55 0.3
56 0.31
57 0.32
58 0.33
59 0.34
60 0.34
61 0.37
62 0.32
63 0.31
64 0.32
65 0.31
66 0.31
67 0.31
68 0.3
69 0.25
70 0.2
71 0.21
72 0.18
73 0.16
74 0.15
75 0.15
76 0.15
77 0.17
78 0.19
79 0.2
80 0.25
81 0.31
82 0.33
83 0.33
84 0.34
85 0.36
86 0.38
87 0.41
88 0.43
89 0.4
90 0.47
91 0.54
92 0.56
93 0.61
94 0.61
95 0.57
96 0.54
97 0.57
98 0.54
99 0.51
100 0.5
101 0.42
102 0.39
103 0.37
104 0.34
105 0.31
106 0.25
107 0.23
108 0.19
109 0.19
110 0.17
111 0.19
112 0.2
113 0.17
114 0.16
115 0.13
116 0.14
117 0.14
118 0.16
119 0.16
120 0.16
121 0.16
122 0.18
123 0.19
124 0.2
125 0.22
126 0.21
127 0.23
128 0.23
129 0.23
130 0.21
131 0.21
132 0.21
133 0.19
134 0.2
135 0.17
136 0.15
137 0.15
138 0.15
139 0.14
140 0.12
141 0.11
142 0.09
143 0.08
144 0.15
145 0.22
146 0.27
147 0.31
148 0.34
149 0.39
150 0.45
151 0.54
152 0.58
153 0.61
154 0.62
155 0.63
156 0.63
157 0.61
158 0.59
159 0.57
160 0.55
161 0.55
162 0.53
163 0.5
164 0.48
165 0.49
166 0.47
167 0.43
168 0.36
169 0.31
170 0.28
171 0.27
172 0.26
173 0.22
174 0.23
175 0.27
176 0.27
177 0.23
178 0.22
179 0.21
180 0.22
181 0.24
182 0.27
183 0.27
184 0.32
185 0.32
186 0.31
187 0.32
188 0.3
189 0.31
190 0.33
191 0.31
192 0.27
193 0.28
194 0.29
195 0.34
196 0.43
197 0.48
198 0.48
199 0.51
200 0.49
201 0.52
202 0.58
203 0.56
204 0.5
205 0.45
206 0.41
207 0.37
208 0.35
209 0.32
210 0.25
211 0.2
212 0.18
213 0.13
214 0.1
215 0.07
216 0.07
217 0.06
218 0.06
219 0.06
220 0.05
221 0.05
222 0.04
223 0.04
224 0.04
225 0.03
226 0.03
227 0.02
228 0.02
229 0.02
230 0.02
231 0.03
232 0.04
233 0.05
234 0.06
235 0.11
236 0.17
237 0.21
238 0.25
239 0.32
240 0.35
241 0.39
242 0.42
243 0.43
244 0.45
245 0.45
246 0.48
247 0.49
248 0.47
249 0.43
250 0.4
251 0.35
252 0.25
253 0.22
254 0.15
255 0.08
256 0.07
257 0.05
258 0.05
259 0.04
260 0.04
261 0.03
262 0.03
263 0.02
264 0.03
265 0.03
266 0.03
267 0.04
268 0.04
269 0.05
270 0.1
271 0.13
272 0.17
273 0.2
274 0.28
275 0.36
276 0.46
277 0.53
278 0.59
279 0.66
280 0.69
281 0.77
282 0.8
283 0.81
284 0.78
285 0.81
286 0.77
287 0.7
288 0.71
289 0.62
290 0.56
291 0.49
292 0.41
293 0.33
294 0.27
295 0.27
296 0.23
297 0.23
298 0.24
299 0.25
300 0.31
301 0.4
302 0.44
303 0.52
304 0.6
305 0.69
306 0.77
307 0.83
308 0.88
309 0.87