Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BJC0

Protein Details
Accession A0A2V1BJC0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-137VENRKEGKEEKKVEKERERERRERRMLRCRBasic
NLS Segment(s)
PositionSequence
86-135KRKEREKKAKEEMEKEEKEKWVVENRKEGKEEKKVEKERERERRERRMLR
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MSTPNKTQSTTPASAPTAKANSTNSTTPTTTSSSSAPSPQDAEVNAMMGFNRLDLGINGLANSMWATPGMTFGTKQLILDAQDAEKRKEREKKAKEEMEKEEKEKWVVENRKEGKEEKKVEKERERERRERRMLRCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.37
4 0.32
5 0.3
6 0.31
7 0.29
8 0.31
9 0.32
10 0.32
11 0.29
12 0.31
13 0.3
14 0.28
15 0.28
16 0.27
17 0.24
18 0.23
19 0.21
20 0.2
21 0.21
22 0.23
23 0.21
24 0.19
25 0.2
26 0.18
27 0.19
28 0.16
29 0.17
30 0.14
31 0.13
32 0.12
33 0.1
34 0.09
35 0.09
36 0.08
37 0.05
38 0.05
39 0.04
40 0.05
41 0.04
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.04
51 0.03
52 0.03
53 0.04
54 0.03
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.1
66 0.1
67 0.11
68 0.09
69 0.13
70 0.15
71 0.17
72 0.22
73 0.23
74 0.3
75 0.38
76 0.47
77 0.54
78 0.61
79 0.69
80 0.73
81 0.79
82 0.78
83 0.76
84 0.75
85 0.74
86 0.69
87 0.62
88 0.56
89 0.49
90 0.44
91 0.38
92 0.34
93 0.34
94 0.39
95 0.41
96 0.47
97 0.5
98 0.54
99 0.56
100 0.57
101 0.55
102 0.57
103 0.61
104 0.6
105 0.66
106 0.69
107 0.76
108 0.81
109 0.81
110 0.82
111 0.85
112 0.85
113 0.84
114 0.86
115 0.87
116 0.88
117 0.89