Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BBM6

Protein Details
Accession A0A2V1BBM6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-76TSITCRKKIYKQWATRWDFPLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, golg 7, plas 4, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRITSLDLNYGGIFVRVLLFPYVLFLLFPDLLLQNQRLHYINTDKDRNLGSKPIATSITCRKKIYKQWATRWDFPLLNKIPTRRYHYYYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.06
4 0.08
5 0.08
6 0.08
7 0.07
8 0.09
9 0.09
10 0.08
11 0.07
12 0.06
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.1
20 0.12
21 0.11
22 0.12
23 0.14
24 0.14
25 0.14
26 0.16
27 0.2
28 0.23
29 0.26
30 0.28
31 0.26
32 0.27
33 0.28
34 0.27
35 0.23
36 0.22
37 0.17
38 0.17
39 0.17
40 0.18
41 0.18
42 0.17
43 0.19
44 0.27
45 0.35
46 0.37
47 0.38
48 0.4
49 0.47
50 0.56
51 0.63
52 0.63
53 0.63
54 0.69
55 0.78
56 0.81
57 0.8
58 0.75
59 0.69
60 0.61
61 0.53
62 0.53
63 0.45
64 0.44
65 0.42
66 0.43
67 0.45
68 0.49
69 0.57
70 0.54