Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1BLL3

Protein Details
Accession A0A2V1BLL3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-64PKDSAEYKLKSKKEKAPKAHKPPKEPTPPKPKNPPPAKDVPIBasic
NLS Segment(s)
PositionSequence
30-58KLKSKKEKAPKAHKPPKEPTPPKPKNPPP
Subcellular Location(s) cyto 16.5, cyto_nucl 14, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001412  aa-tRNA-synth_I_CS  
IPR004514  Gln-tRNA-synth  
IPR000924  Glu/Gln-tRNA-synth  
IPR020058  Glu/Gln-tRNA-synth_Ib_cat-dom  
IPR020059  Glu/Gln-tRNA-synth_Ib_codon-bd  
IPR020056  Rbsml_L25/Gln-tRNA_synth_N  
IPR011035  Ribosomal_L25/Gln-tRNA_synth  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004819  F:glutamine-tRNA ligase activity  
GO:0006425  P:glutaminyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00749  tRNA-synt_1c  
PF03950  tRNA-synt_1c_C  
PROSITE View protein in PROSITE  
PS00178  AA_TRNA_LIGASE_I  
Amino Acid Sequences MADNIQSSEAVDSATVKSIAHPPKDSAEYKLKSKKEKAPKAHKPPKEPTPPKPKNPPPAKDVPIDPDSMFKGGFLADVSQRRPVGHNGVNKVVTRFPPEPNGFLHLGHSKAIMINFGFARFHGGDCYLRFDDTNPAGEEEKYFVAIEEMVSWLGFKPIKITHSSDNFDHLYELAEDLIRRDGAYVCHCTKAEVVAQRGGGKNRPRYACPHRNRPSSESLTEFRAMRDGKYKPQEAVLRMKQNLEDGNPQMWDLAAYRVLDSEEKPVRHYRTGDKWKIYPTYDFTHCLCDSLEGITHSLCTTEFELSRVSYEWLCDKVEVYKPMQREFGRLNVSGTVLSKRKIISLIENGCVRDWDDPRLYTLIALRRRGVPPGSILTFVNELGVTKAETTIDIKRFEQVVRRYLENTVPRLMLVLDPIPVVIENLPEDYIEMVELPFSKDPAFGVHTVPFTKTVYIDRSDFRETASKDFFRLAPGGSVGLLKVPFPITATGFETDPTTGLVTLVRAHYEKPEEGVTFKKPKTYIHWVAACPKNSPVKATVRVFNPLFNSDNPDSHPDGFLAVVNPTSEEIYPNAMVETGLSEVKRRAPWPNLEGERDISPGETRPETVRFQGMRVAYFCLDRDTTDDNIVLNRIVSLKEDAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.15
5 0.24
6 0.31
7 0.35
8 0.36
9 0.37
10 0.42
11 0.49
12 0.48
13 0.46
14 0.49
15 0.48
16 0.55
17 0.61
18 0.62
19 0.64
20 0.72
21 0.75
22 0.76
23 0.82
24 0.83
25 0.86
26 0.9
27 0.92
28 0.93
29 0.91
30 0.89
31 0.88
32 0.87
33 0.88
34 0.85
35 0.84
36 0.85
37 0.86
38 0.86
39 0.88
40 0.87
41 0.87
42 0.89
43 0.84
44 0.8
45 0.81
46 0.76
47 0.69
48 0.63
49 0.59
50 0.51
51 0.48
52 0.4
53 0.34
54 0.32
55 0.28
56 0.24
57 0.17
58 0.15
59 0.12
60 0.12
61 0.09
62 0.1
63 0.15
64 0.2
65 0.22
66 0.27
67 0.28
68 0.29
69 0.31
70 0.34
71 0.37
72 0.38
73 0.44
74 0.43
75 0.48
76 0.5
77 0.48
78 0.45
79 0.41
80 0.38
81 0.38
82 0.36
83 0.34
84 0.4
85 0.41
86 0.41
87 0.38
88 0.41
89 0.34
90 0.31
91 0.32
92 0.26
93 0.25
94 0.23
95 0.21
96 0.17
97 0.17
98 0.17
99 0.16
100 0.12
101 0.14
102 0.14
103 0.15
104 0.14
105 0.12
106 0.18
107 0.16
108 0.16
109 0.15
110 0.17
111 0.19
112 0.19
113 0.26
114 0.21
115 0.21
116 0.21
117 0.21
118 0.26
119 0.25
120 0.28
121 0.22
122 0.24
123 0.24
124 0.24
125 0.24
126 0.19
127 0.17
128 0.14
129 0.13
130 0.11
131 0.1
132 0.1
133 0.09
134 0.07
135 0.08
136 0.07
137 0.06
138 0.07
139 0.06
140 0.1
141 0.1
142 0.09
143 0.13
144 0.16
145 0.19
146 0.23
147 0.26
148 0.3
149 0.36
150 0.4
151 0.36
152 0.38
153 0.36
154 0.32
155 0.29
156 0.21
157 0.16
158 0.13
159 0.13
160 0.08
161 0.08
162 0.08
163 0.09
164 0.1
165 0.09
166 0.08
167 0.09
168 0.1
169 0.12
170 0.16
171 0.22
172 0.21
173 0.25
174 0.25
175 0.25
176 0.24
177 0.23
178 0.24
179 0.23
180 0.24
181 0.24
182 0.25
183 0.27
184 0.3
185 0.3
186 0.32
187 0.34
188 0.39
189 0.44
190 0.46
191 0.45
192 0.5
193 0.59
194 0.63
195 0.63
196 0.67
197 0.69
198 0.74
199 0.76
200 0.73
201 0.7
202 0.65
203 0.6
204 0.53
205 0.46
206 0.41
207 0.39
208 0.34
209 0.25
210 0.25
211 0.23
212 0.2
213 0.26
214 0.25
215 0.3
216 0.37
217 0.38
218 0.33
219 0.39
220 0.42
221 0.38
222 0.45
223 0.44
224 0.44
225 0.43
226 0.44
227 0.38
228 0.36
229 0.33
230 0.27
231 0.24
232 0.19
233 0.2
234 0.19
235 0.18
236 0.15
237 0.14
238 0.12
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.09
245 0.09
246 0.1
247 0.1
248 0.16
249 0.19
250 0.19
251 0.22
252 0.27
253 0.3
254 0.33
255 0.35
256 0.35
257 0.41
258 0.51
259 0.54
260 0.52
261 0.51
262 0.52
263 0.52
264 0.47
265 0.39
266 0.33
267 0.32
268 0.31
269 0.31
270 0.27
271 0.29
272 0.27
273 0.25
274 0.21
275 0.17
276 0.15
277 0.13
278 0.13
279 0.08
280 0.08
281 0.07
282 0.08
283 0.07
284 0.06
285 0.06
286 0.06
287 0.07
288 0.08
289 0.09
290 0.09
291 0.1
292 0.1
293 0.11
294 0.1
295 0.1
296 0.08
297 0.09
298 0.1
299 0.11
300 0.11
301 0.1
302 0.1
303 0.12
304 0.16
305 0.17
306 0.18
307 0.2
308 0.21
309 0.23
310 0.28
311 0.25
312 0.24
313 0.24
314 0.27
315 0.27
316 0.26
317 0.25
318 0.2
319 0.2
320 0.17
321 0.16
322 0.15
323 0.13
324 0.13
325 0.14
326 0.14
327 0.14
328 0.16
329 0.16
330 0.16
331 0.23
332 0.25
333 0.25
334 0.26
335 0.26
336 0.24
337 0.23
338 0.19
339 0.16
340 0.15
341 0.16
342 0.17
343 0.17
344 0.19
345 0.19
346 0.18
347 0.14
348 0.17
349 0.2
350 0.22
351 0.24
352 0.23
353 0.26
354 0.27
355 0.29
356 0.27
357 0.21
358 0.19
359 0.21
360 0.21
361 0.18
362 0.17
363 0.16
364 0.15
365 0.14
366 0.12
367 0.08
368 0.07
369 0.07
370 0.07
371 0.06
372 0.05
373 0.06
374 0.05
375 0.06
376 0.09
377 0.14
378 0.17
379 0.18
380 0.19
381 0.2
382 0.22
383 0.23
384 0.28
385 0.27
386 0.3
387 0.3
388 0.31
389 0.31
390 0.31
391 0.36
392 0.33
393 0.31
394 0.27
395 0.25
396 0.23
397 0.22
398 0.2
399 0.14
400 0.11
401 0.09
402 0.07
403 0.07
404 0.07
405 0.07
406 0.06
407 0.06
408 0.05
409 0.05
410 0.05
411 0.06
412 0.06
413 0.06
414 0.06
415 0.06
416 0.06
417 0.05
418 0.05
419 0.04
420 0.05
421 0.05
422 0.07
423 0.07
424 0.08
425 0.08
426 0.08
427 0.09
428 0.11
429 0.13
430 0.12
431 0.14
432 0.16
433 0.18
434 0.18
435 0.19
436 0.18
437 0.16
438 0.16
439 0.15
440 0.16
441 0.18
442 0.2
443 0.21
444 0.21
445 0.26
446 0.28
447 0.27
448 0.25
449 0.29
450 0.28
451 0.32
452 0.36
453 0.32
454 0.29
455 0.32
456 0.3
457 0.25
458 0.25
459 0.19
460 0.14
461 0.14
462 0.13
463 0.11
464 0.11
465 0.08
466 0.09
467 0.09
468 0.08
469 0.09
470 0.09
471 0.09
472 0.1
473 0.12
474 0.11
475 0.13
476 0.16
477 0.16
478 0.15
479 0.15
480 0.15
481 0.14
482 0.12
483 0.11
484 0.09
485 0.08
486 0.08
487 0.08
488 0.07
489 0.1
490 0.1
491 0.11
492 0.11
493 0.12
494 0.16
495 0.2
496 0.2
497 0.2
498 0.23
499 0.21
500 0.23
501 0.26
502 0.29
503 0.34
504 0.34
505 0.37
506 0.36
507 0.39
508 0.45
509 0.51
510 0.52
511 0.51
512 0.56
513 0.53
514 0.61
515 0.63
516 0.57
517 0.48
518 0.46
519 0.46
520 0.41
521 0.42
522 0.39
523 0.4
524 0.47
525 0.49
526 0.5
527 0.44
528 0.51
529 0.48
530 0.45
531 0.41
532 0.36
533 0.35
534 0.3
535 0.35
536 0.3
537 0.31
538 0.31
539 0.33
540 0.33
541 0.31
542 0.31
543 0.23
544 0.21
545 0.2
546 0.18
547 0.14
548 0.11
549 0.11
550 0.1
551 0.1
552 0.1
553 0.11
554 0.1
555 0.11
556 0.11
557 0.14
558 0.15
559 0.14
560 0.14
561 0.12
562 0.12
563 0.1
564 0.11
565 0.08
566 0.1
567 0.1
568 0.13
569 0.15
570 0.21
571 0.26
572 0.28
573 0.34
574 0.39
575 0.48
576 0.5
577 0.58
578 0.57
579 0.57
580 0.56
581 0.51
582 0.45
583 0.38
584 0.33
585 0.25
586 0.21
587 0.2
588 0.22
589 0.21
590 0.21
591 0.24
592 0.28
593 0.3
594 0.32
595 0.38
596 0.34
597 0.34
598 0.38
599 0.35
600 0.34
601 0.33
602 0.33
603 0.26
604 0.27
605 0.26
606 0.25
607 0.24
608 0.21
609 0.24
610 0.24
611 0.25
612 0.26
613 0.26
614 0.22
615 0.23
616 0.24
617 0.19
618 0.15
619 0.14
620 0.13
621 0.13
622 0.15
623 0.19
624 0.25