Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BKU1

Protein Details
Accession A0A2V1BKU1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-96RELVSREKLRMKRRKNVSSNRPGNGSHydrophilic
NLS Segment(s)
PositionSequence
80-85RMKRRK
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MASAIFSPQLKYGRRKSTFLSFVISDEELSVSVYSDVEQDCTHPATPNASRSPVSPSMMSQIIVNNGSLMRELVSREKLRMKRRKNVSSNRPGNGSGMSKHMSPILEVRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.57
3 0.58
4 0.61
5 0.6
6 0.53
7 0.49
8 0.38
9 0.35
10 0.35
11 0.3
12 0.2
13 0.16
14 0.15
15 0.1
16 0.1
17 0.09
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.09
28 0.11
29 0.11
30 0.11
31 0.11
32 0.15
33 0.17
34 0.21
35 0.21
36 0.22
37 0.21
38 0.21
39 0.27
40 0.24
41 0.24
42 0.19
43 0.18
44 0.19
45 0.19
46 0.18
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.05
58 0.06
59 0.08
60 0.11
61 0.17
62 0.18
63 0.22
64 0.3
65 0.37
66 0.47
67 0.56
68 0.6
69 0.64
70 0.73
71 0.81
72 0.82
73 0.86
74 0.86
75 0.87
76 0.87
77 0.8
78 0.73
79 0.63
80 0.55
81 0.48
82 0.4
83 0.3
84 0.27
85 0.26
86 0.23
87 0.23
88 0.24
89 0.2
90 0.19