Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BUY0

Protein Details
Accession A0A2V1BUY0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
214-250RAVRTLKRPNNTSKDKRDKGKERARQRSRSNETSEREHydrophilic
NLS Segment(s)
PositionSequence
213-242HRAVRTLKRPNNTSKDKRDKGKERARQRSR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MEIQTLDLTDEDLLSIHRYYITCLYLEDKKTDIEIVQHLYEKYKFQVTLPQIRKCIKDWKLELPISPELKPEEPKEPDTPSDDGWVVIPSMTDPPVLTTNSYTPSDPKLMSLYTKRPLPSLPASKSNTKMDSKSRVRKRQAPNTDRVRGICHHGAGSSESHEIETNLSSVPDGPSQMELYVDDDQDHERVAQGLTSMAFARAGHYNEGLPRHHRAVRTLKRPNNTSKDKRDKGKERARQRSRSNETSEREMSHES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.12
5 0.12
6 0.15
7 0.19
8 0.2
9 0.18
10 0.19
11 0.23
12 0.27
13 0.29
14 0.28
15 0.25
16 0.24
17 0.25
18 0.25
19 0.21
20 0.18
21 0.19
22 0.21
23 0.21
24 0.24
25 0.23
26 0.25
27 0.26
28 0.25
29 0.24
30 0.25
31 0.24
32 0.22
33 0.3
34 0.33
35 0.42
36 0.47
37 0.5
38 0.51
39 0.54
40 0.56
41 0.51
42 0.55
43 0.51
44 0.53
45 0.51
46 0.54
47 0.58
48 0.57
49 0.55
50 0.5
51 0.5
52 0.43
53 0.39
54 0.33
55 0.28
56 0.29
57 0.31
58 0.29
59 0.3
60 0.31
61 0.35
62 0.36
63 0.36
64 0.35
65 0.36
66 0.34
67 0.27
68 0.26
69 0.22
70 0.19
71 0.16
72 0.15
73 0.1
74 0.09
75 0.08
76 0.06
77 0.07
78 0.07
79 0.07
80 0.06
81 0.08
82 0.1
83 0.11
84 0.11
85 0.11
86 0.12
87 0.15
88 0.17
89 0.15
90 0.14
91 0.16
92 0.18
93 0.17
94 0.16
95 0.15
96 0.14
97 0.17
98 0.2
99 0.22
100 0.23
101 0.26
102 0.26
103 0.25
104 0.25
105 0.26
106 0.29
107 0.32
108 0.31
109 0.36
110 0.38
111 0.41
112 0.44
113 0.42
114 0.39
115 0.34
116 0.34
117 0.32
118 0.38
119 0.43
120 0.5
121 0.57
122 0.62
123 0.66
124 0.72
125 0.77
126 0.78
127 0.8
128 0.76
129 0.75
130 0.74
131 0.72
132 0.64
133 0.56
134 0.49
135 0.39
136 0.39
137 0.32
138 0.24
139 0.2
140 0.19
141 0.19
142 0.17
143 0.16
144 0.12
145 0.11
146 0.1
147 0.11
148 0.11
149 0.1
150 0.1
151 0.09
152 0.08
153 0.07
154 0.07
155 0.06
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.09
162 0.1
163 0.1
164 0.1
165 0.08
166 0.11
167 0.12
168 0.12
169 0.11
170 0.11
171 0.12
172 0.12
173 0.12
174 0.09
175 0.08
176 0.09
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.08
183 0.08
184 0.07
185 0.08
186 0.08
187 0.1
188 0.13
189 0.15
190 0.15
191 0.16
192 0.17
193 0.2
194 0.23
195 0.24
196 0.24
197 0.27
198 0.31
199 0.34
200 0.35
201 0.39
202 0.47
203 0.54
204 0.6
205 0.66
206 0.67
207 0.72
208 0.77
209 0.79
210 0.78
211 0.79
212 0.78
213 0.79
214 0.83
215 0.83
216 0.86
217 0.87
218 0.87
219 0.87
220 0.88
221 0.87
222 0.87
223 0.9
224 0.91
225 0.9
226 0.89
227 0.89
228 0.87
229 0.86
230 0.83
231 0.81
232 0.76
233 0.74
234 0.69
235 0.59