Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1BA98

Protein Details
Accession A0A2V1BA98    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-140KEAPRPKEKGAPKPKVRPGTPKRKRRGALGRGELBasic
NLS Segment(s)
PositionSequence
100-135KERFRTPKEAPRPKEKGAPKPKVRPGTPKRKRRGAL
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEAEEKRRQLQEAQIVRNISVEDPFNDTSAPPAPSFLQEITGNKRKAQPTVKVTHNAKTTAQKRQKQVWEATARTWRAADKSHDSQVVENMMASSKVASKERFRTPKEAPRPKEKGAPKPKVRPGTPKRKRRGALGRGELETQTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.46
4 0.43
5 0.36
6 0.26
7 0.2
8 0.17
9 0.14
10 0.18
11 0.19
12 0.18
13 0.17
14 0.16
15 0.17
16 0.19
17 0.19
18 0.14
19 0.15
20 0.15
21 0.16
22 0.19
23 0.16
24 0.16
25 0.16
26 0.2
27 0.26
28 0.34
29 0.33
30 0.33
31 0.39
32 0.38
33 0.43
34 0.47
35 0.47
36 0.46
37 0.51
38 0.53
39 0.55
40 0.55
41 0.54
42 0.5
43 0.43
44 0.39
45 0.42
46 0.42
47 0.44
48 0.51
49 0.51
50 0.53
51 0.6
52 0.63
53 0.59
54 0.58
55 0.55
56 0.52
57 0.47
58 0.46
59 0.43
60 0.38
61 0.33
62 0.3
63 0.23
64 0.18
65 0.21
66 0.22
67 0.22
68 0.26
69 0.28
70 0.29
71 0.29
72 0.27
73 0.26
74 0.23
75 0.16
76 0.13
77 0.1
78 0.08
79 0.08
80 0.07
81 0.06
82 0.07
83 0.1
84 0.13
85 0.16
86 0.22
87 0.29
88 0.39
89 0.46
90 0.48
91 0.52
92 0.57
93 0.64
94 0.7
95 0.73
96 0.69
97 0.71
98 0.75
99 0.71
100 0.72
101 0.7
102 0.7
103 0.7
104 0.75
105 0.74
106 0.78
107 0.83
108 0.83
109 0.81
110 0.81
111 0.8
112 0.81
113 0.82
114 0.83
115 0.83
116 0.84
117 0.82
118 0.81
119 0.82
120 0.8
121 0.8
122 0.79
123 0.75
124 0.67
125 0.66