Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1C776

Protein Details
Accession A0A2V1C776    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-24GAKAASKRDRKDDKTKVAKSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAASKRDRKDDKTKVAKSQLKVNEKAMDIQCVICKSTFLKTTRAPALTEHATNKHSKTLADCFPNFVAAPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.79
4 0.81
5 0.81
6 0.79
7 0.79
8 0.78
9 0.69
10 0.68
11 0.66
12 0.62
13 0.6
14 0.55
15 0.49
16 0.43
17 0.46
18 0.38
19 0.31
20 0.24
21 0.22
22 0.2
23 0.17
24 0.17
25 0.11
26 0.11
27 0.1
28 0.13
29 0.18
30 0.19
31 0.23
32 0.25
33 0.3
34 0.34
35 0.34
36 0.31
37 0.27
38 0.31
39 0.28
40 0.29
41 0.26
42 0.25
43 0.26
44 0.28
45 0.28
46 0.28
47 0.26
48 0.25
49 0.27
50 0.31
51 0.35
52 0.4
53 0.39
54 0.38
55 0.38
56 0.39
57 0.34