Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CBE6

Protein Details
Accession A0A2V1CBE6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDTVHydrophilic
75-110KDKYTIFDRKEKKYRKSIRKLPKWTRVSQRVNPPGYHydrophilic
NLS Segment(s)
PositionSequence
83-97RKEKKYRKSIRKLPK
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNSLCSGLLWKIPWRLSKFQKARQRKRLRAVDTVVAVVDNALAKQGATMKAVERWKDEMPIEQEMVPKDKYTIFDRKEKKYRKSIRKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.24
5 0.27
6 0.31
7 0.35
8 0.38
9 0.45
10 0.5
11 0.59
12 0.64
13 0.68
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.87
20 0.88
21 0.88
22 0.83
23 0.79
24 0.71
25 0.64
26 0.54
27 0.45
28 0.35
29 0.25
30 0.19
31 0.12
32 0.09
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.06
40 0.07
41 0.08
42 0.08
43 0.09
44 0.14
45 0.17
46 0.18
47 0.18
48 0.21
49 0.21
50 0.23
51 0.23
52 0.22
53 0.23
54 0.24
55 0.22
56 0.2
57 0.22
58 0.2
59 0.23
60 0.19
61 0.16
62 0.15
63 0.16
64 0.18
65 0.21
66 0.3
67 0.3
68 0.39
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.8
76 0.82
77 0.86
78 0.87
79 0.88
80 0.9
81 0.93
82 0.92
83 0.92
84 0.88
85 0.86
86 0.86
87 0.86
88 0.84
89 0.81
90 0.82