Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1B5W8

Protein Details
Accession A0A2V1B5W8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
88-109KVEIPNKKKRVKKTIIKKVSKGBasic
NLS Segment(s)
PositionSequence
92-109PNKKKRVKKTIIKKVSKG
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSKNEAITIFEEKHPNKIGVFVFNQSSAYASKGSRALNAFTINLGKGGALFPQKDTYFPPNISKSKRARGLVSTIQKLNYKVEKVIKVEIPNKKKRVKKTIIKKVSKGIKQILIEKRCLLTIKNCQSLSALVWKATFDDARQAAFKALDSYPLNTLRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.38
4 0.33
5 0.36
6 0.33
7 0.3
8 0.31
9 0.28
10 0.26
11 0.25
12 0.25
13 0.2
14 0.2
15 0.15
16 0.14
17 0.14
18 0.12
19 0.15
20 0.18
21 0.18
22 0.21
23 0.22
24 0.22
25 0.23
26 0.24
27 0.21
28 0.18
29 0.19
30 0.15
31 0.13
32 0.12
33 0.08
34 0.07
35 0.07
36 0.09
37 0.1
38 0.11
39 0.12
40 0.17
41 0.17
42 0.17
43 0.21
44 0.23
45 0.24
46 0.26
47 0.3
48 0.32
49 0.37
50 0.4
51 0.45
52 0.45
53 0.49
54 0.54
55 0.51
56 0.47
57 0.44
58 0.45
59 0.45
60 0.44
61 0.39
62 0.34
63 0.34
64 0.33
65 0.32
66 0.29
67 0.25
68 0.2
69 0.21
70 0.25
71 0.26
72 0.26
73 0.28
74 0.27
75 0.29
76 0.35
77 0.4
78 0.44
79 0.49
80 0.54
81 0.59
82 0.63
83 0.67
84 0.71
85 0.73
86 0.73
87 0.76
88 0.81
89 0.84
90 0.84
91 0.78
92 0.75
93 0.74
94 0.69
95 0.63
96 0.56
97 0.52
98 0.48
99 0.53
100 0.54
101 0.48
102 0.46
103 0.42
104 0.38
105 0.34
106 0.33
107 0.26
108 0.25
109 0.32
110 0.38
111 0.44
112 0.43
113 0.41
114 0.42
115 0.41
116 0.35
117 0.33
118 0.26
119 0.2
120 0.2
121 0.2
122 0.2
123 0.21
124 0.2
125 0.13
126 0.19
127 0.19
128 0.21
129 0.22
130 0.22
131 0.21
132 0.21
133 0.21
134 0.17
135 0.16
136 0.21
137 0.22
138 0.24
139 0.27
140 0.34