Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1C3M2

Protein Details
Accession A0A2V1C3M2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-85SAELRRARSKSRSPMRARKISGHydrophilic
NLS Segment(s)
PositionSequence
68-82RRARSKSRSPMRARK
Subcellular Location(s) mito 9, plas 9, cyto 4, E.R. 2, nucl 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
GO:0016779  F:nucleotidyltransferase activity  
Amino Acid Sequences MSRSSSNPIPATPRVISPSPTPSESREASQEGYFGPVTRSARKKQAASEAPIDEEIDEDDEDVSAELRRARSKSRSPMRARKISGLTPAKPTTAPATKPPPLTPNGNGHAAATNGHLSPTSANAGWSWRDISRSPSPLGLIPIHRHWRSFVHRHEVPRKVLHVSIGFFTIWLYVSGVQTNAITPYLMSALIPIAATDYLRHTYPALNRLYVRVLGALMRETEYAGWNGVIWYLLGAWIVLGFFPKDVGVMGILLLSWCDTAASTIGRAYGRYTPRIRRGKSLAGSLAAFAVGVITAAVFWGWLAPRTGPFVDDIDWPFMFTGTLSLPAAVRNTLGLSLGKASISGGLALAVMSLWTGFVASASEVVDIFGWDDNLTIPVLSGIGMWGFLRIFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.38
4 0.36
5 0.41
6 0.39
7 0.4
8 0.4
9 0.38
10 0.42
11 0.42
12 0.4
13 0.37
14 0.35
15 0.35
16 0.33
17 0.3
18 0.23
19 0.24
20 0.22
21 0.17
22 0.16
23 0.2
24 0.23
25 0.31
26 0.37
27 0.4
28 0.49
29 0.55
30 0.58
31 0.58
32 0.65
33 0.64
34 0.63
35 0.63
36 0.55
37 0.5
38 0.46
39 0.4
40 0.29
41 0.22
42 0.17
43 0.12
44 0.1
45 0.09
46 0.08
47 0.07
48 0.08
49 0.07
50 0.07
51 0.06
52 0.08
53 0.11
54 0.14
55 0.19
56 0.22
57 0.29
58 0.37
59 0.46
60 0.55
61 0.62
62 0.7
63 0.74
64 0.82
65 0.85
66 0.85
67 0.8
68 0.77
69 0.72
70 0.65
71 0.65
72 0.61
73 0.54
74 0.52
75 0.49
76 0.43
77 0.38
78 0.36
79 0.33
80 0.32
81 0.32
82 0.32
83 0.38
84 0.41
85 0.44
86 0.45
87 0.43
88 0.4
89 0.43
90 0.41
91 0.4
92 0.39
93 0.38
94 0.36
95 0.32
96 0.29
97 0.24
98 0.21
99 0.14
100 0.13
101 0.1
102 0.1
103 0.09
104 0.09
105 0.09
106 0.1
107 0.11
108 0.09
109 0.1
110 0.1
111 0.12
112 0.13
113 0.13
114 0.14
115 0.12
116 0.15
117 0.16
118 0.22
119 0.26
120 0.28
121 0.28
122 0.27
123 0.27
124 0.26
125 0.28
126 0.24
127 0.2
128 0.2
129 0.25
130 0.32
131 0.31
132 0.31
133 0.3
134 0.34
135 0.39
136 0.44
137 0.44
138 0.44
139 0.48
140 0.55
141 0.62
142 0.61
143 0.57
144 0.52
145 0.49
146 0.42
147 0.39
148 0.34
149 0.27
150 0.22
151 0.19
152 0.17
153 0.14
154 0.12
155 0.11
156 0.09
157 0.07
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.05
169 0.05
170 0.04
171 0.05
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.06
185 0.07
186 0.07
187 0.08
188 0.08
189 0.11
190 0.14
191 0.2
192 0.2
193 0.2
194 0.21
195 0.22
196 0.22
197 0.19
198 0.16
199 0.1
200 0.09
201 0.08
202 0.08
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.06
214 0.06
215 0.06
216 0.05
217 0.04
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.05
249 0.06
250 0.06
251 0.06
252 0.09
253 0.09
254 0.09
255 0.11
256 0.17
257 0.2
258 0.27
259 0.33
260 0.39
261 0.49
262 0.58
263 0.58
264 0.58
265 0.61
266 0.63
267 0.6
268 0.57
269 0.48
270 0.41
271 0.39
272 0.31
273 0.25
274 0.16
275 0.13
276 0.07
277 0.05
278 0.03
279 0.03
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.02
287 0.04
288 0.05
289 0.06
290 0.08
291 0.09
292 0.11
293 0.15
294 0.15
295 0.14
296 0.15
297 0.16
298 0.16
299 0.19
300 0.2
301 0.2
302 0.2
303 0.2
304 0.18
305 0.16
306 0.15
307 0.11
308 0.11
309 0.07
310 0.1
311 0.09
312 0.1
313 0.1
314 0.12
315 0.13
316 0.11
317 0.11
318 0.09
319 0.1
320 0.09
321 0.11
322 0.1
323 0.09
324 0.11
325 0.11
326 0.1
327 0.1
328 0.1
329 0.1
330 0.1
331 0.09
332 0.07
333 0.06
334 0.06
335 0.06
336 0.06
337 0.04
338 0.04
339 0.03
340 0.03
341 0.03
342 0.03
343 0.03
344 0.03
345 0.04
346 0.05
347 0.05
348 0.06
349 0.07
350 0.07
351 0.07
352 0.08
353 0.08
354 0.07
355 0.08
356 0.08
357 0.08
358 0.07
359 0.08
360 0.08
361 0.09
362 0.09
363 0.08
364 0.07
365 0.07
366 0.07
367 0.07
368 0.06
369 0.05
370 0.05
371 0.06
372 0.06
373 0.07